Gene Information

Name : Rxyl_3017 (Rxyl_3017)
Accession : YP_645739.1
Strain : Rubrobacter xylanophilus DSM 9941
Genome accession: NC_008148
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3024867 - 3025544 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver transcriptional regulatory protein-like; KEGG: dra:DR0743 response regulator

DNA sequence :
ATGCGTCCGGGCACGCGCATACTGGTGGTAGAGGACGACCCCTCCATCGCCCGGCTGCTGCAGCTGGAGCTCGAGCACCG
GGGGTACGAGGTCTGCTGCGCCGCGGACGGGGAGGAGGGGCTCGCCGCCTTCGAGCGGCTCCGGCCCGACGTGGTGGTGC
TCGACATCATGCTCCCGGGGATGGACGGGGTGGGGGTGCTCAGGCGACTCCGGGAGGCCGGGCACCGGACCCCGGTGATC
ATGCTGACCGCCCGCGACGCCACCGGGGACAAGGTGCACAGCCTGGACCGCGGCGCCGACGACTACCTCACCAAGCCGTT
CGAGGTCGAGGAGCTGCTGGCCCGGATGCGGGCGGTGCTGCGGCGGGTGGAGGGGGAGGAGGTGCTGCGGGTGGGGAGCC
TCACCGTGGACACCTCCGCCCGCGAGGTCCGGCGGGGCGGGCGGGCCGTGGCGCTCACGGCCCGCGAGTACGACCTTCTG
GAGCTCCTCGCCCGCAACGGCCGCCGGGTGCTCTCGAGGGAGAAGATCCTGGACCGGGTCTGGGGCGAGGGGGCGGGCGT
GGACCCGAACGTGGTGGACGTGTACGTCGGGTACCTGCGCCGGAAGCTCGAGGGGCCCGGGGAGGGGCGGCTCATCCACA
CCGTGCGCGGGGTGGGCTACGTGCTCAGGGAGGACTAG

Protein sequence :
MRPGTRILVVEDDPSIARLLQLELEHRGYEVCCAADGEEGLAAFERLRPDVVVLDIMLPGMDGVGVLRRLREAGHRTPVI
MLTARDATGDKVHSLDRGADDYLTKPFEVEELLARMRAVLRRVEGEEVLRVGSLTVDTSAREVRRGGRAVALTAREYDLL
ELLARNGRRVLSREKILDRVWGEGAGVDPNVVDVYVGYLRRKLEGPGEGRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-25 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_3017 YP_645739.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-36 49
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-32 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator BAC0197 Protein 2e-29 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator BAC0125 Protein 2e-30 47
Rxyl_3017 YP_645739.1 two component transcriptional regulator BAC0308 Protein 5e-29 46
Rxyl_3017 YP_645739.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-31 46
Rxyl_3017 YP_645739.1 two component transcriptional regulator BAC0083 Protein 7e-28 44
Rxyl_3017 YP_645739.1 two component transcriptional regulator NC_002516.2.879194.p Protein 6e-25 41
Rxyl_3017 YP_645739.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_3017 YP_645739.1 two component transcriptional regulator VFG1390 Protein 8e-39 54
Rxyl_3017 YP_645739.1 two component transcriptional regulator VFG1386 Protein 4e-38 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator VFG1389 Protein 1e-35 48
Rxyl_3017 YP_645739.1 two component transcriptional regulator VFG0596 Protein 3e-25 43