Gene Information

Name : ECP_3807 (ECP_3807)
Accession : YP_671679.1
Strain : Escherichia coli 536
Genome accession: NC_008253
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3978277 - 3978579 bp
Length : 303 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAACTACACGGTGGCAGA
TGCCGCCAAAGCTATGGATATCGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTGAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDIGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQRIEME
NEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-41 100
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-41 100
api80 CAF28554.1 putative transposase Not tested YAPI Protein 7e-35 95
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-39 93
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 77
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 77
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-31 77
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 77
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 77
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 77
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 77
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 77
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 9e-30 72
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-24 61
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-24 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-23 59
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-23 59
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-23 59
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-23 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 8e-23 57
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-20 49
tnpA CAB61575.1 transposase A Not tested HPI Protein 4e-20 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECP_3807 YP_671679.1 transposase VFG1485 Protein 1e-41 100
ECP_3807 YP_671679.1 transposase VFG1123 Protein 9e-32 77
ECP_3807 YP_671679.1 transposase VFG1553 Protein 4e-30 72
ECP_3807 YP_671679.1 transposase VFG0784 Protein 2e-23 59
ECP_3807 YP_671679.1 transposase VFG1566 Protein 9e-13 42