Gene Information

Name : ECP_4549 (ECP_4549)
Accession : YP_672386.1
Strain : Escherichia coli 536
Genome accession: NC_008253
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4757034 - 4757369 bp
Length : 336 bp
Strand : +
Note : -

DNA sequence :
GTGATATGCTCACCTCAACATCTTACAGGTGAACCAATGAGCAAAGCATTTACTGCTGAATTTAAAGTCGAAGCGGCAAA
ACTGGTCCTGGATCAGAACTACACTCACGGCGAAGCGGCTAAGGCGATGAACGTCAGCCTCTCCGCCATCAACCGCTGGG
TAAAATCGTTACGTATGGAGCGCCAGGGGAAAACGCCCCCGGGGCTGCCTCTGACGCCTGAGCAGACTGAACTCAGGGAA
ATGAGAAAACGAATACAACGCCTTGAAATGGAGAATGAAATCCTAAAAAAGGCTACCGCGCTCTTGATGTCGGACTCCCT
GAACAGTTCACGATAA

Protein sequence :
MICSPQHLTGEPMSKAFTAEFKVEAAKLVLDQNYTHGEAAKAMNVSLSAINRWVKSLRMERQGKTPPGLPLTPEQTELRE
MRKRIQRLEMENEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-41 100
l7045 CAD33744.1 - Not tested PAI I 536 Protein 8e-30 72
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 8e-30 72
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-28 66
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-29 65
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-29 65
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-29 65
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 65
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-29 65
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-29 65
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-29 65
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-29 65
api80 CAF28554.1 putative transposase Not tested YAPI Protein 8e-24 64
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-21 58
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-24 54
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-24 54
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-23 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-23 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-23 53
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-21 53
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-16 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECP_4549 YP_672386.1 transposase VFG1553 Protein 2e-41 100
ECP_4549 YP_672386.1 transposase VFG1485 Protein 3e-30 72
ECP_4549 YP_672386.1 transposase VFG1123 Protein 7e-30 65
ECP_4549 YP_672386.1 transposase VFG0784 Protein 4e-24 53