Gene Information

Name : fliQ (Meso_0273)
Accession : YP_672842.1
Strain : Chelativorans sp. BNC1
Genome accession: NC_008254
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 313097 - 313363 bp
Length : 267 bp
Strand : -
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum

DNA sequence :
ATGAACGAGGCGGACGCTCTCGATATTGTCCAATATGCGATTTGGACAGTGCTTCTGGCGTCCGGCCCGGCCGTGATCGT
CGCCATGGTCGTCGGTGTCGGAATAGCGCTGGTCCAGGCTCTTACGCAGGTTCAGGAAATCACCCTCACTTTCGTGCCGA
AGATTGTCGCCATCATGCTCGCAATCGCCCTGTCGGGCCCGTTCGTCGGCACGCAGATCTCCTCCTTCACGAATGTGATC
TTTCAGCGGATCGAGAACGGATTTTAA

Protein sequence :
MNEADALDIVQYAIWTVLLASGPAVIVAMVVGVGIALVQALTQVQEITLTFVPKIVAIMLAIALSGPFVGTQISSFTNVI
FQRIENGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
escS CAC81848.1 EscS protein Virulence LEE II Protein 2e-04 44
escS AAK26701.1 EscS Virulence LEE Protein 2e-04 44
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 3e-04 44
escS AAL57528.1 EscS Virulence LEE Protein 2e-04 44
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 3e-04 44
escS AAC38370.1 EscS Virulence LEE Protein 3e-04 42
escS AAC31527.1 L0048 Virulence LEE Protein 3e-04 42
escS ACU09472.1 hypothetical protein Not tested LEE Protein 3e-04 42
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 4e-04 42
escS CAI43888.1 EscS protein Virulence LEE Protein 2e-04 42
escS NP_290282.1 hypothetical protein Virulence LEE Protein 4e-04 42
ECs4582 NP_312609.1 EscS Virulence LEE Protein 4e-04 42
ssaS CAA68200.1 secretion system apparatus, SsaS Virulence SPI-2 Protein 0.001 41
ssaS YP_216428.1 secretion system apparatus protein SsaS Virulence SPI-2 Protein 0.002 41
ssaS NP_460385.1 type III secretion system apparatus protein Virulence SPI-2 Protein 0.002 41
unnamed AAL06355.1 EscS Virulence LEE Protein 2e-04 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_672842.1 flagellar biosynthesis protein FliQ VFG0826 Protein 1e-04 42
fliQ YP_672842.1 flagellar biosynthesis protein FliQ VFG0716 Protein 1e-04 42
fliQ YP_672842.1 flagellar biosynthesis protein FliQ VFG0520 Protein 5e-04 41