Gene Information

Name : RHA1_ro08200 (RHA1_ro08200)
Accession : YP_707403.1
Strain :
Genome accession: NC_008269
Putative virulence/resistance : Resistance
Product : tellerium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 198068 - 198643 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCACCCTTGCCAAAGGCGGCAACGTATCCCTCGACAAGCAGGCCCCGAACCTGACCGCGGTCGCGGTCGGATT
GGGCTGGGACGCGCGATCGACCACCGGCCACGAATTCGACCTCGACGCCAGCGCTCTGGCAACGGGCGAGAACAAGAAGG
TCCTGTCGGATCAGCACTTCGTGTTCTACAACAACCTGCGCTCCCCGGACGGGTCGATCCAGCACGAAGGGGACAACCTC
ACCGGCGAGGGCGACGGTGACGACGAGGTGATCAACGTCGACCTCAAGGCCGTGCCGCCGAACGTCACCAACATCTTCTT
CCCCGTCTCCATCCATGAGGCAGAACTGCGTGGTCAGAACTTCGGGCAGGTCACCAACGCGTTCATCCGCGTCGTCGATC
GCAGTACCGGCAACGAACTGGTCCGCTACGACCTGTCCGAGGACGCATCCAGCGAGACCGCGATGACCTTCGGTGAGCTC
TACCGGCACAACGGGGAGTGGAAGTTCCGTGCCATCGGCCAGGGCTACGCGTCCGGGCTGTCCGGTATCGCCCGCGACTA
CGGCGTCAACATCTGA

Protein sequence :
MGVTLAKGGNVSLDKQAPNLTAVAVGLGWDARSTTGHEFDLDASALATGENKKVLSDQHFVFYNNLRSPDGSIQHEGDNL
TGEGDGDDEVINVDLKAVPPNVTNIFFPVSIHEAELRGQNFGQVTNAFIRVVDRSTGNELVRYDLSEDASSETAMTFGEL
YRHNGEWKFRAIGQGYASGLSGIARDYGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-57 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-57 63
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-57 63
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-57 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-56 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-56 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-56 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-30 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-27 41
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHA1_ro08200 YP_707403.1 tellerium resistance protein BAC0390 Protein 5e-59 62
RHA1_ro08200 YP_707403.1 tellerium resistance protein BAC0389 Protein 6e-57 62
RHA1_ro08200 YP_707403.1 tellerium resistance protein BAC0392 Protein 9e-27 41