Gene Information

Name : FRAAL0606 (FRAAL0606)
Accession : YP_710887.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 666418 - 667002 bp
Length : 585 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type s : structural protein

DNA sequence :
ATGGCAGTCAGCCTCGCCAAGGGTGGCAACGTAAGCCTCACGAAGCAGGCCGCGGAGGCCGGCACCGCCCAGCTCACCGC
GCTGAACGTCGGGCTCGGCTGGGACGCCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCGGCCATCGGCCTGC
GGGCGGACGGCAAGGCCTTCAACGACAGCTACTTCATCTTCTACAACAACCTCGCCTCGCCCGAGGGGGCGATCACGCTG
ACCGGCGACAACAAGACGGGGCAGGGCGAGGGCGACGACGAGTCCATCATCATCAACCTGCCCTCGGTGCCCGCCGAGAT
CGAACGGATCGTCGTCCCCGTCTCGATCTATGACGCGGTGAACCGCAGCCAGAACTTCGGCCAGGTGCGCAACGCCTACA
TCCGGGTCGTCGACCAGGGCGGCAACGAGCTGGTTCGGTACGACCTGTCCGAGGACTACTCCACCGAGACGGTCGTGATC
TTCGGCGAGGTCTACCGCAACGGCGCGGACTGGAAGTTCCGGGCCGTGGGCCAGGGCCACAACGACCTCGGTGGCCTGGC
CCGCGACCACGGCGTCAGCGTCTGA

Protein sequence :
MAVSLAKGGNVSLTKQAAEAGTAQLTALNVGLGWDARTTTGTDFDLDASAIGLRADGKAFNDSYFIFYNNLASPEGAITL
TGDNKTGQGEGDDESIIINLPSVPAEIERIVVPVSIYDAVNRSQNFGQVRNAYIRVVDQGGNELVRYDLSEDYSTETVVI
FGEVYRNGADWKFRAVGQGHNDLGGLARDHGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 57
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-46 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-45 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-44 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FRAAL0606 YP_710887.1 tellurium resistance protein BAC0389 Protein 2e-44 56
FRAAL0606 YP_710887.1 tellurium resistance protein BAC0390 Protein 4e-47 54