Gene Information

Name : phoB (FRAAL0967)
Accession : YP_711229.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Virulence
Product : two-component regulatory system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1032337 - 1033017 bp
Length : 681 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
GTGACCCGGCTGCTCGTGGTCGAGGACGAGGAGTCCTTCTCCGATGCGTTGTCCTTCATGCTGGAACGGGAGGGCTTCGA
GGTCGGGGTCGTCGCCGACGGCCCCAGTGCGCTGGCCGAGTTCGACCGGCGCGGCGCCGATCTCGTCCTGCTCGACCTCA
TGCTGCCCGGCCTGTCCGGCACCGAGGTGTGCCGCACGCTGCGGACCAGGTCCAGCGTGCCGATCATCATGTTGACCGCG
CGGGACAGCGAGATCGACAAGGTGCTCGGCCTGGAACTCGGCGCGGACGACTACGTCACCAAGCCGTTCTCGGCCCGCGA
GCTCGTCGCCCGGATCCGGGCCGTGCTGCGCCGCCGGTCGGAGACGGAGGAGGTCGCGGAGGCCACCCTGGAGGCCGGGC
CGGTCCGGATGGACGTCGAACGGCACGTCGTCACGGTCGACGGCAGCATGGTCACCCTCCCGCTCAAGGAGTTCGAACTC
CTCGAGATGTTCCTACGCAACGCCGGGCGGGTACTCACGCGGGGTCAGTTGATCGACCGGGTGTGGGGCTCGGACTACGT
GGGTGACACGAAGACCCTGGACGTACATGTCAAGAGGCTGCGGACGAAGATTGAGCGCGAACCCGGGAATCCGCGGCATC
TGGTGACCGTGCGGGGCCTGGGTTACAAGTTCGAGCCGTGA

Protein sequence :
MTRLLVVEDEESFSDALSFMLEREGFEVGVVADGPSALAEFDRRGADLVLLDLMLPGLSGTEVCRTLRTRSSVPIIMLTA
RDSEIDKVLGLELGADDYVTKPFSARELVARIRAVLRRRSETEEVAEATLEAGPVRMDVERHVVTVDGSMVTLPLKEFEL
LEMFLRNAGRVLTRGQLIDRVWGSDYVGDTKTLDVHVKRLRTKIEREPGNPRHLVTVRGLGYKFEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_711229.1 two-component regulatory system response regulator AE000516.2.gene3505. Protein 2e-34 48
phoB YP_711229.1 two-component regulatory system response regulator HE999704.1.gene2815. Protein 2e-31 46
phoB YP_711229.1 two-component regulatory system response regulator NC_002952.2859905.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_007793.3914279.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_002758.1121668.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_003923.1003749.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_009782.5559369.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_002951.3237708.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_007622.3794472.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_002745.1124361.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_009641.5332272.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_013450.8614421.p0 Protein 1e-33 46
phoB YP_711229.1 two-component regulatory system response regulator NC_012469.1.7686381. Protein 2e-31 44
phoB YP_711229.1 two-component regulatory system response regulator NC_012469.1.7685629. Protein 6e-34 44
phoB YP_711229.1 two-component regulatory system response regulator HE999704.1.gene1528. Protein 1e-24 43
phoB YP_711229.1 two-component regulatory system response regulator AE016830.1.gene1681. Protein 7e-33 42
phoB YP_711229.1 two-component regulatory system response regulator NC_011595.7057856.p0 Protein 2e-26 41
phoB YP_711229.1 two-component regulatory system response regulator NC_010410.6002989.p0 Protein 2e-26 41
phoB YP_711229.1 two-component regulatory system response regulator NC_010400.5986590.p0 Protein 2e-26 41
phoB YP_711229.1 two-component regulatory system response regulator BAC0083 Protein 2e-21 41
phoB YP_711229.1 two-component regulatory system response regulator BAC0533 Protein 3e-18 41
phoB YP_711229.1 two-component regulatory system response regulator CP000647.1.gene4257. Protein 3e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_711229.1 two-component regulatory system response regulator VFG1386 Protein 2e-20 43
phoB YP_711229.1 two-component regulatory system response regulator VFG1389 Protein 9e-21 43
phoB YP_711229.1 two-component regulatory system response regulator VFG1390 Protein 4e-24 41
phoB YP_711229.1 two-component regulatory system response regulator VFG0596 Protein 3e-18 41