Gene Information

Name : Tery_0954 (Tery_0954)
Accession : YP_720817.1
Strain : Trichodesmium erythraeum IMS101
Genome accession: NC_008312
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1503514 - 1504245 bp
Length : 732 bp
Strand : -
Note : PFAM: response regulator receiveR transcriptional regulatory protein-like; KEGG: syf:Synpcc7942_1453 two component transcriptional regulator, winged helix family

DNA sequence :
GTGGAATATAATAAAGAAAAAATCTTGGTTGTTGATGATGAAGCAAGTATTCGTCGTATTTTAGAAACTCGACTGTCAAT
GATTGGGTATGATGTTGTTACTGCTGCTGATGGTGAAGAAGCTTTGGAGACTTTTCACAATACAACCCCAGATCTGGTGG
TATTAGATGTGATGATGCCAAAATTAGATGGTTATGGTGTCTGCCAAGAATTACGCAAAGAATCAGATATTCCTATAATT
ATGCTAACTGCTTTGGGAGATGTTGCAGATAGAATTACAGGTCTAGAATTAGGTGCTGATGATTATGTGGTGAAGCCTTT
TTCTCCAAAAGAATTAGAAGCAAGAATTCGTTCTGTATTACGTCGGGTCGATAAAAATGGTGGTAATGGTATTCCTAGTT
CTGGTGTTATTCAAGTCAGCACTATTAGAATTGACACTAATAAACGTCAGGTTTATAAAGGTGATGAAAGAATTAGACTA
ACTGGTATGGAGTTTAGTTTATTAGAGTTATTGGTAAGTCGTTCTGGAGAGCCTTTTTCTCGTTCTGAGATTTTGCAGGA
AGTTTGGGGTTACACTCCAGAGCGTCATGTAGATACGCGAGTAGTGGATGTTCATATTTCTAGGCTTAGGGCTAAGTTGG
AAGAAGATCCAAGTAACCCAGAATTGATTTTAACTGCACGAGGCACTGGTTATCTATTTCAACGAATTATTGAACGTGAT
GAAGTTGGTTGA

Protein sequence :
MEYNKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFHNTTPDLVVLDVMMPKLDGYGVCQELRKESDIPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVDKNGGNGIPSSGVIQVSTIRIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEEDPSNPELILTARGTGYLFQRIIERD
EVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-47 49
Tery_0954 YP_720817.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-47 48
Tery_0954 YP_720817.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-43 45
Tery_0954 YP_720817.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-43 45
Tery_0954 YP_720817.1 two component transcriptional regulator BAC0125 Protein 9e-39 44
Tery_0954 YP_720817.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-41 44
Tery_0954 YP_720817.1 two component transcriptional regulator CP001918.1.gene5135. Protein 9e-26 43
Tery_0954 YP_720817.1 two component transcriptional regulator CP000034.1.gene3671. Protein 6e-39 43
Tery_0954 YP_720817.1 two component transcriptional regulator BAC0083 Protein 9e-37 42
Tery_0954 YP_720817.1 two component transcriptional regulator BAC0638 Protein 5e-29 42
Tery_0954 YP_720817.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 41
Tery_0954 YP_720817.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-38 41
Tery_0954 YP_720817.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-32 41
Tery_0954 YP_720817.1 two component transcriptional regulator CP004022.1.gene3215. Protein 2e-34 41
Tery_0954 YP_720817.1 two component transcriptional regulator CP000647.1.gene4257. Protein 1e-29 41
Tery_0954 YP_720817.1 two component transcriptional regulator CP001138.1.gene4273. Protein 5e-29 41
Tery_0954 YP_720817.1 two component transcriptional regulator BAC0533 Protein 1e-29 41
Tery_0954 YP_720817.1 two component transcriptional regulator BAC0197 Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tery_0954 YP_720817.1 two component transcriptional regulator VFG1390 Protein 1e-39 44
Tery_0954 YP_720817.1 two component transcriptional regulator VFG0596 Protein 2e-30 42
Tery_0954 YP_720817.1 two component transcriptional regulator VFG1389 Protein 4e-33 42
Tery_0954 YP_720817.1 two component transcriptional regulator VFG1386 Protein 9e-36 41