Gene Information

Name : h16_A1818 (H16_A1818)
Accession : YP_726290.1
Strain :
Genome accession: NC_008313
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1980146 - 1980844 bp
Length : 699 bp
Strand : +
Note : REC (residues 5 to 117, 5e-26) with a complete phosphorylation pocket (DD-D55-T96-K108)

DNA sequence :
ATGTCGCGCCAGGTTCTGGTGATCGAGGACGACGCAGATATCGCCGAACTGGTACGGCTGCAGGTGAGCGGGCTGTCTTG
CGACGTGAAGGTGATCAACCACGGCAGGGCGGGACTGGAAGAGGCGCTGAGTCGTCCCTATGACCTGGTCATCCTGGACC
TGATGCTGCCGGGCGCCGACGGGCTGGAAATCTGTCGGCGCCTGCGCGCGGAACCGCGCTATACCCCCATCCTCATGCTC
ACGGCGCGCTCGACTGAACTGGACCGGGTGCTGGGACTGGAGATGGGCGCCGACGACTACCTGACCAAGCCGTTCAGCGT
CCTTGAGCTGACCGCGCGGGTCAAGGCGATCTTCCGGCTGGTCGACACCCTGGCCAACCCGCCATCCGATGGTCCCAGGA
CGGTGCAGGTCAAGGCCCTGCACATCGATATCGACAAGCGTGAAGTGAGCGTGCGCGGCACGCCGATCTGCCTCACCGCC
AAGGAATTCCAGCTGCTGCTCTACTTTGCCAGCAATCCGGGGCGCGTCTTCAGCCGCGCCCAGTTGCTGGACCAGGTCTG
GGGCTATAGCCACAGTGGCTACGAGCACACGGTAAGTTCGCATATCAACCGGCTGCGCGCCAAGATCGAACTCGACCCCA
ACGAGCCGGAGTACATCCAGACCGTCTGGGGCGTGGGCTACAAGTTCTGCAATACGTAA

Protein sequence :
MSRQVLVIEDDADIAELVRLQVSGLSCDVKVINHGRAGLEEALSRPYDLVILDLMLPGADGLEICRRLRAEPRYTPILML
TARSTELDRVLGLEMGADDYLTKPFSVLELTARVKAIFRLVDTLANPPSDGPRTVQVKALHIDIDKREVSVRGTPICLTA
KEFQLLLYFASNPGRVFSRAQLLDQVWGYSHSGYEHTVSSHINRLRAKIELDPNEPEYIQTVWGVGYKFCNT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-50 51
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-50 51
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
h16_A1818 YP_726290.1 response regulator AE016830.1.gene1681. Protein 1e-47 46
h16_A1818 YP_726290.1 response regulator HE999704.1.gene2815. Protein 5e-47 45
h16_A1818 YP_726290.1 response regulator NC_003923.1003749.p0 Protein 5e-43 43
h16_A1818 YP_726290.1 response regulator NC_002758.1121668.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_009641.5332272.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_013450.8614421.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_007793.3914279.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_002745.1124361.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_009782.5559369.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_002951.3237708.p0 Protein 7e-43 43
h16_A1818 YP_726290.1 response regulator NC_002952.2859858.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_007622.3794948.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_003923.1003417.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_013450.8614146.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_002951.3238224.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_007793.3914065.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_002758.1121390.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator NC_010079.5776364.p0 Protein 6e-37 42
h16_A1818 YP_726290.1 response regulator AE015929.1.gene1106. Protein 4e-33 42
h16_A1818 YP_726290.1 response regulator NC_012469.1.7686381. Protein 2e-44 42
h16_A1818 YP_726290.1 response regulator NC_002952.2859905.p0 Protein 9e-43 42
h16_A1818 YP_726290.1 response regulator NC_007622.3794472.p0 Protein 1e-42 42
h16_A1818 YP_726290.1 response regulator AE000516.2.gene3505. Protein 1e-38 42
h16_A1818 YP_726290.1 response regulator HE999704.1.gene1528. Protein 3e-34 41
h16_A1818 YP_726290.1 response regulator AF155139.2.orf0.gene Protein 5e-40 41
h16_A1818 YP_726290.1 response regulator NC_012469.1.7685629. Protein 4e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
h16_A1818 YP_726290.1 response regulator VFG1563 Protein 1e-50 51
h16_A1818 YP_726290.1 response regulator VFG1702 Protein 7e-51 51
h16_A1818 YP_726290.1 response regulator VFG0596 Protein 5e-31 42
h16_A1818 YP_726290.1 response regulator VFG1389 Protein 2e-26 41