Gene Information

Name : Neut_0034 (Neut_0034)
Accession : YP_746289.1
Strain : Nitrosomonas eutropha C91
Genome accession: NC_008344
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 35591 - 36067 bp
Length : 477 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein, MerR; KEGG: sty:HCM1.151c putative mercuric resistance operon regulatory protein

DNA sequence :
ATGCGAACTAATTTTAAGAATGTGACTATTGGCGTTTTTGCCAAGGCGGCCGGAGTCAATGTGGAGACCATCCGGTTCTA
CCAGCGCAAGGGCCTGCTGTCGGAGCCAGACAAGCCCTATGGCAGCATTCGCCGCTATGGCGAGGCGGATGTAACACGGG
TGCGCTTTGTGAAATCGGCCCAGCGGCTGGGCTTTAGCCTGGATGAAATCGCCGAGCTCCTACGGCTAGATGACGGAACA
CATTGCGAGGAAGCCAGCGGCCTAGCCGAGCACAAGCTCAAGGATGTGCGCGAAAAGATGGCCGATTTGGCGCGCATGGA
GGCCGTGCTGTCTGAACTGGTGTGCGCCTGCCACTCACGGAAGGGAAACGTTACCTGCCCGCTGATTGCGTCACTGCAAG
ACGGAGCGAACCTCGCGGTGTCGGTGCAGAGTGGTCATGGGTTGACTACGCAGCCTGCTTTATTTTCCGAATTCTGA

Protein sequence :
MRTNFKNVTIGVFAKAAGVNVETIRFYQRKGLLSEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLDDGT
HCEEASGLAEHKLKDVREKMADLARMEAVLSELVCACHSRKGNVTCPLIASLQDGANLAVSVQSGHGLTTQPALFSEF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-56 90
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-56 90
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-56 90
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-56 90
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 7e-62 89
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 5e-62 89
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-55 89
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-55 89
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 8e-47 75
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-43 71
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-27 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0687 Protein 2e-57 91
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0232 Protein 2e-57 91
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0684 Protein 3e-57 90
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0683 Protein 5e-57 89
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0688 Protein 5e-56 89
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0686 Protein 9e-54 87
Neut_0034 YP_746289.1 transcriptional regulator MerR BAC0689 Protein 1e-58 85