Gene Information

Name : Sfri_1610 (Sfri_1610)
Accession : YP_750299.1
Strain : Shewanella frigidimarina NCIMB 400
Genome accession: NC_008345
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1916762 - 1917073 bp
Length : 312 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: vch:VCA0792 transposase OrfAB, subunit A

DNA sequence :
ATGAGATCGATAACCAGAAAAACATTTAGTGCTGAATTCAAACTTGAAGCAGCCCAATTAGTCCTCGATAAAAACCATAG
CATCATCGAAGCAGCAAAGGCGATGAACGTGGGTAAATCAACCATGGATAAATGGGTGAGACAGTTAAAACTAGAACGCC
AGGGTGGCACGCCAAAAGCCTCTCCCATTACCCCTGAACAAATTGAAATCCGTGAACTGAAGAAACAGGTAGCCCGTCTT
GAGGAGCATAATCTTATTCTAAAAAAGGCTACCGCTCTCTTGATGTCAGACTCGATGAACAATTTACGCTGA

Protein sequence :
MRSITRKTFSAEFKLEAAQLVLDKNHSIIEAAKAMNVGKSTMDKWVRQLKLERQGGTPKASPITPEQIEIRELKKQVARL
EEHNLILKKATALLMSDSMNNLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-32 85
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-32 85
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-32 85
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-32 85
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-32 85
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-32 85
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-32 85
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-32 85
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-26 66
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-26 66
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-25 65
api80 CAF28554.1 putative transposase Not tested YAPI Protein 7e-22 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-27 64
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-27 64
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-26 63
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-26 63
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-26 63
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-26 63
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 62
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 7e-21 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-16 49
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-16 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 45
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-11 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfri_1610 YP_750299.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-32 85
Sfri_1610 YP_750299.1 transposase IS3/IS911 family protein VFG1485 Protein 9e-27 66
Sfri_1610 YP_750299.1 transposase IS3/IS911 family protein VFG0784 Protein 2e-26 63
Sfri_1610 YP_750299.1 transposase IS3/IS911 family protein VFG1553 Protein 8e-24 62
Sfri_1610 YP_750299.1 transposase IS3/IS911 family protein VFG1566 Protein 7e-13 45
Sfri_1610 YP_750299.1 transposase IS3/IS911 family protein VFG1521 Protein 9e-12 43