Gene Information

Name : Mmar10_0943 (Mmar10_0943)
Accession : YP_756174.1
Strain : Maricaulis maris MCS10
Genome accession: NC_008347
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1039061 - 1039732 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rpc:RPC_1842 two component transcriptional regulator, winged helix family

DNA sequence :
GTGCGCATTCTGATCGTTGAAGACGACCGCGAAGCAGCCAGCTATATCCGCAAGGGCCTTCGCGAAAGCGGCCATGTGGC
CGACCATGCCGGTGACGGCGAAGAGGGCCTGGAAATGGCCCGCGCCGCGGAATACGACGTGCTCGTTGTTGACCGCATGA
TGCCGCGCATGGACGGGCTTTCGATGGTCGAGGCGCTGCGCGCCGACGATGATCGCACCCCGGTCCTCATCCTCTCTGCC
CTCGGCGAGGTCGATGACCGTGTCGAAGGGCTGAAGGCGGGCGGCGATGACTATCTGGTCAAGCCCTACGCCTTTGCCGA
ATTGCTGGCCCGCGTCGAGGCCCTGGCCCGTCGCCGTGATCCGGATACCGTCCGGACCAAGCTGGTGGTCGGTGATCTGG
AAATGGACCTGCTGGCCCGCACGGTGATCCGTGAGGGCGAGGACATCCTGCTCCAGCCCCGCGAATTCCGCTTGCTGGAA
TTCCTGATGAAGCATTCCGGCCAGGTGGTGACCCGCACCATGTTGCTGGAAAAAGTCTGGGACTATCATTTCGACCCCCA
GACCAATGTCATTGATGTGCACATTTCGCGTCTGCGCTCGAAGATCGACAAACCCTTCCCGCGCTCGTTGCTGCACACGG
TGCGCGGAGCCGGTTACCGTCTGCAGGCCTGA

Protein sequence :
MRILIVEDDREAASYIRKGLRESGHVADHAGDGEEGLEMARAAEYDVLVVDRMMPRMDGLSMVEALRADDDRTPVLILSA
LGEVDDRVEGLKAGGDDYLVKPYAFAELLARVEALARRRDPDTVRTKLVVGDLEMDLLARTVIREGEDILLQPREFRLLE
FLMKHSGQVVTRTMLLEKVWDYHFDPQTNVIDVHISRLRSKIDKPFPRSLLHTVRGAGYRLQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-41 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0125 Protein 8e-47 49
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0347 Protein 4e-44 48
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0083 Protein 3e-44 48
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0197 Protein 2e-42 48
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0111 Protein 2e-47 47
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0308 Protein 8e-41 46
Mmar10_0943 YP_756174.1 two component transcriptional regulator BAC0638 Protein 5e-36 45
Mmar10_0943 YP_756174.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmar10_0943 YP_756174.1 two component transcriptional regulator VFG1389 Protein 7e-31 49
Mmar10_0943 YP_756174.1 two component transcriptional regulator VFG0596 Protein 9e-42 46
Mmar10_0943 YP_756174.1 two component transcriptional regulator VFG1390 Protein 8e-34 43