Gene Information

Name : RL3687 (RL3687)
Accession : YP_769266.1
Strain : Rhizobium leguminosarum 3841
Genome accession: NC_008380
Putative virulence/resistance : Resistance
Product : transmembrane efflux protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 3888180 - 3888521 bp
Length : 342 bp
Strand : -
Note : -

DNA sequence :
ATGAGCCAGGCCGCCGTCTACGGGCTGCTGTTTGCAGCCATCGTGCTCGAGGTCATCGGCACGACCGCGCTGCAGCTGTC
GCAGCAGTTTACCCGCATCGGGCCGACGGCACTCGTCGTCGCTTGTTATGCGGCCGCCTTCTATTGCCTGTCGCTGACTC
TGAAAAGCATCCCGGTCGGTATCGCCTATGCGATTTGGAGCGCTTTGGGAATCGTGCTGATTTCCTCGGTCGGCCTGGTG
TTTTTCAAGCAGCGCCTCGACCTGCCGGCAATCGTCGGCCTTGGGCTGATCATATCGGGCGTTATGGTCGTCAATCTGTT
CTCGAAATCCGTTTCGCATTGA

Protein sequence :
MSQAAVYGLLFAAIVLEVIGTTALQLSQQFTRIGPTALVVACYAAAFYCLSLTLKSIPVGIAYAIWSALGIVLISSVGLV
FFKQRLDLPAIVGLGLIISGVMVVNLFSKSVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-18 53
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 9e-18 53
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 6e-18 53
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-18 53
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 6e-18 53
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 6e-18 53
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 6e-18 53
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 6e-18 53
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 6e-18 53
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 6e-18 53
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 9e-18 53
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 6e-18 53
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 6e-18 53
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 9e-18 53
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 6e-18 53
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-18 53
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 9e-18 53
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 6e-18 53
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-18 53
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 9e-18 53
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RL3687 YP_769266.1 transmembrane efflux protein BAC0002 Protein 7e-22 59
RL3687 YP_769266.1 transmembrane efflux protein NC_010410.6003348.p0 Protein 7e-22 59
RL3687 YP_769266.1 transmembrane efflux protein BAC0324 Protein 7e-23 58
RL3687 YP_769266.1 transmembrane efflux protein BAC0377 Protein 7e-22 57
RL3687 YP_769266.1 transmembrane efflux protein NC_002695.1.913273.p Protein 2e-20 55
RL3687 YP_769266.1 transmembrane efflux protein BAC0150 Protein 2e-20 55
RL3687 YP_769266.1 transmembrane efflux protein CP001138.1.gene1489. Protein 3e-25 54
RL3687 YP_769266.1 transmembrane efflux protein BAC0322 Protein 4e-22 54
RL3687 YP_769266.1 transmembrane efflux protein CP004022.1.gene1549. Protein 1e-19 54
RL3687 YP_769266.1 transmembrane efflux protein BAC0323 Protein 3e-18 53
RL3687 YP_769266.1 transmembrane efflux protein BAC0139 Protein 3e-15 45
RL3687 YP_769266.1 transmembrane efflux protein BAC0140 Protein 1e-12 44
RL3687 YP_769266.1 transmembrane efflux protein BAC0192 Protein 7e-17 44
RL3687 YP_769266.1 transmembrane efflux protein BAC0329 Protein 2e-10 43
RL3687 YP_769266.1 transmembrane efflux protein BAC0325 Protein 5e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RL3687 YP_769266.1 transmembrane efflux protein VFG1587 Protein 7e-13 42