Gene Information

Name : pRL70161 (pRL70161)
Accession : YP_770882.1
Strain :
Genome accession: NC_008382
Putative virulence/resistance : Unknown
Product : transposase-related protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 133322 - 133672 bp
Length : 351 bp
Strand : +
Note : similarity:fasta; with=UniProt:Q70MR8_PSEFL (EMBL:PFL563381); Pseudomonas fluorescens.; TnpB protein.; length=114; id 58.491; 106 aa overlap; query 1-106; subject 1-105; similarity:fasta; with=UniProt:Q8KLD0_RHIET (EMBL:U80928); Rhizobium etli.; Hypotheti

DNA sequence :
ATGATCGCCTTTCCGGCCGGGGTGAAGGTATGGATCGCGGGCGGGGTGACGGACATGCGTTGCGGCATGAACAGCCTGGC
GCTGAAGGTTCAGCAAGGCCTTGGCCGCGATCCTCATGGCGGTGAGGTCTTCTGCTTCCGAGGTCGCAAGGGCGATCTGA
TCAAGGTCCTGTGGCATGACGGGATTGGCATGTCGCTCTATTTGAAGCGGCTGGAAGCTGGGAAGTTCATATGGCCGGTC
AGCCAGAATGGCTCCGCCGTGCCAGTGTCGGCAGCGCAACTCGGCTATCTTCTGGAAGGGATCGACTGGCGCAATCCCCG
CTGGACGCAACGGCCTGCGACGGCAGGCTAA

Protein sequence :
MIAFPAGVKVWIAGGVTDMRCGMNSLALKVQQGLGRDPHGGEVFCFRGRKGDLIKVLWHDGIGMSLYLKRLEAGKFIWPV
SQNGSAVPVSAAQLGYLLEGIDWRNPRWTQRPATAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-24 56
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-28 53
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-28 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-28 53
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-24 53
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-24 53
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-24 53
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-24 53
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-24 53
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-24 53
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-23 53
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-24 53
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-23 53
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-24 53
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-24 53
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-24 53
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 9e-18 52
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-28 51
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-28 51
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-24 51
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-24 48
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-24 48
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-23 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-23 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-24 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pRL70161 YP_770882.1 transposase-related protein VFG1665 Protein 3e-28 53
pRL70161 YP_770882.1 transposase-related protein VFG1698 Protein 1e-24 53
pRL70161 YP_770882.1 transposase-related protein VFG1709 Protein 1e-24 53
pRL70161 YP_770882.1 transposase-related protein VFG0792 Protein 1e-24 53
pRL70161 YP_770882.1 transposase-related protein VFG1517 Protein 4e-18 52
pRL70161 YP_770882.1 transposase-related protein VFG1052 Protein 3e-24 51
pRL70161 YP_770882.1 transposase-related protein VFG1737 Protein 5e-25 46