Gene Information

Name : Bamb_2836 (Bamb_2836)
Accession : YP_774726.1
Strain :
Genome accession: NC_008390
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3128996 - 3129343 bp
Length : 348 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: rso:RSc2314 probable transposase protein

DNA sequence :
ATGCTCGCCATGAAGAGATGTCCGATGACCAAACAACGTCGTACGTTTTCCCCGGAGTTCAAACAGCAAGCTGCCTGCCT
AGTGCTCGACCAAGGCTATCGCTATACCGAGGCGAGCCGCTCAGTCGACGTCGGCGAATCGGTATCGCGTCGTGGGGTGC
AGCAGCTTCAACTAGAGCGCCAAGGCGTCACACCGCAGGGCAAGGCGATTACGCCGGATCAACAACGTATCGAGGAATTC
GAGGCACGCATTGAACGCCTCGAGCGGGAGAAGGCCATTTTAAAAAAGGCTACCGCGCTCTTGATGTCGGATGGCACTAC
GCAGTCGCGTGCACGCGTTGTTCATTGA

Protein sequence :
MLAMKRCPMTKQRRTFSPEFKQQAACLVLDQGYRYTEASRSVDVGESVSRRGVQQLQLERQGVTPQGKAITPDQQRIEEF
EARIERLEREKAILKKATALLMSDGTTQSRARVVH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-28 68
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-17 53
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-17 53
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-17 53
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-17 53
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-17 53
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-17 53
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-17 53
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-17 53
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-19 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-19 53
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-18 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-18 52
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 5e-18 52
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 5e-18 52
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-18 52
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-17 50
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-17 50
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-16 49
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-13 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_2836 YP_774726.1 transposase IS3/IS911 family protein VFG1123 Protein 6e-18 53
Bamb_2836 YP_774726.1 transposase IS3/IS911 family protein VFG1553 Protein 1e-18 52
Bamb_2836 YP_774726.1 transposase IS3/IS911 family protein VFG0784 Protein 1e-18 52
Bamb_2836 YP_774726.1 transposase IS3/IS911 family protein VFG1485 Protein 4e-18 50