Gene Information

Name : PEPE_1797 (PEPE_1797)
Accession : YP_805260.1
Strain : Pediococcus pentosaceus ATCC 25745
Genome accession: NC_008525
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1776648 - 1777349 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGCCAAAGATTTTAGTAGTAGATGATGAAAAACCGATTTCTGACATAGTTAAGTTTAATTTAGATAAAGAAGGATACGA
TGTAGTTACTGCATATGATGGTGAGGAAGCTCTTGCCCAAGTCGAAGAAGAAAAGCCCGACTTGATTCTGCTTGATTTGA
TGTTACCAAAAATTGATGGATTAGAGGTTGCGCGCCAAGTAAGAGCAAAACATAATATTCCAATCATCATGGTAACAGCT
AAGGATTCAGAATTAGACAAGGTTGTTGGACTTGAGCTTGGTGCGGATGATTACGTTACTAAGCCATTTTCTAACCGTGA
ACTAGTGGCGCGGGTAAAAGCCAACCTTCGTCGTCAGGATCAATTGCAACAAGATGATGAGACTGTTAAAAATAATATTA
AAATTGGACCTTTAGTGATTAATTCAGATTCATACTCAGTGACTCGTGATGGGATGCAATTAGATTTGACCCATCGTGAA
TTTGAACTTTTACATTATTTGGCTCAACATACGGGCCAAGTGATGACTCGTGAACATCTTCTTCAAACGGTTTGGGGATA
TGATTATTTTGGGGACGTTCGTACAGTGGATGTTACCGTACGTCGTTTGCGCGAAAAAATTGAAGAAACCCCAGGAAACC
CTCAAATTTTGGTTACACGTCGTGGAGTGGGATACTATTTACGTAATCCAGAAAATGATTAA

Protein sequence :
MPKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALAQVEEEKPDLILLDLMLPKIDGLEVARQVRAKHNIPIIMVTA
KDSELDKVVGLELGADDYVTKPFSNRELVARVKANLRRQDQLQQDDETVKNNIKIGPLVINSDSYSVTRDGMQLDLTHRE
FELLHYLAQHTGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEETPGNPQILVTRRGVGYYLRNPEND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_012469.1.7685629. Protein 4e-65 68
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 1e-51 53
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 2e-51 53
PEPE_1797 YP_805260.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-45 53
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 1e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 2e-51 52
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-38 47
PEPE_1797 YP_805260.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 2e-36 47
PEPE_1797 YP_805260.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 3e-37 46
PEPE_1797 YP_805260.1 DNA-binding response regulator BAC0533 Protein 4e-30 46
PEPE_1797 YP_805260.1 DNA-binding response regulator CP000647.1.gene4257. Protein 4e-30 46
PEPE_1797 YP_805260.1 DNA-binding response regulator AE016830.1.gene1681. Protein 1e-39 45
PEPE_1797 YP_805260.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 5e-34 45
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002695.1.915041.p Protein 2e-30 45
PEPE_1797 YP_805260.1 DNA-binding response regulator CP001138.1.gene4273. Protein 1e-29 45
PEPE_1797 YP_805260.1 DNA-binding response regulator CP004022.1.gene3215. Protein 1e-31 45
PEPE_1797 YP_805260.1 DNA-binding response regulator CP000034.1.gene3834. Protein 2e-30 45
PEPE_1797 YP_805260.1 DNA-binding response regulator AM180355.1.gene1830. Protein 2e-36 44
PEPE_1797 YP_805260.1 DNA-binding response regulator AE000516.2.gene3505. Protein 4e-35 44
PEPE_1797 YP_805260.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 1e-36 43
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 6e-37 43
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 6e-37 43
PEPE_1797 YP_805260.1 DNA-binding response regulator AF130997.1.orf0.gene Protein 1e-32 42
PEPE_1797 YP_805260.1 DNA-binding response regulator AE015929.1.gene1106. Protein 2e-31 42
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 1e-36 41
PEPE_1797 YP_805260.1 DNA-binding response regulator BAC0596 Protein 2e-29 41
PEPE_1797 YP_805260.1 DNA-binding response regulator BAC0039 Protein 2e-30 41
PEPE_1797 YP_805260.1 DNA-binding response regulator CP001138.1.gene2239. Protein 2e-29 41
PEPE_1797 YP_805260.1 DNA-binding response regulator CP000647.1.gene2531. Protein 2e-29 41
PEPE_1797 YP_805260.1 DNA-binding response regulator CP000034.1.gene2186. Protein 2e-30 41
PEPE_1797 YP_805260.1 DNA-binding response regulator CP001918.1.gene3444. Protein 3e-29 41
PEPE_1797 YP_805260.1 DNA-binding response regulator NC_002695.1.916589.p Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PEPE_1797 YP_805260.1 DNA-binding response regulator VFG1389 Protein 1e-31 43
PEPE_1797 YP_805260.1 DNA-binding response regulator VFG1563 Protein 8e-33 42
PEPE_1797 YP_805260.1 DNA-binding response regulator VFG1702 Protein 3e-32 42