Gene Information

Name : Acid_6282 (Acid_6282)
Accession : YP_827493.1
Strain : Candidatus Solibacter usitatus Ellin6076
Genome accession: NC_008536
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 7890483 - 7891175 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: aba:Acid345_2990 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCCGAAGAAGATCGCCATAGTCGAGGACGAAGCGGAGCTTGCATCCTTGATTGAGTACAACTTGACCCGTCACGGTTA
CGAGACCCAGATCCTCGGCGGCGGTACCGGGACCATGCGCGCCCTGGAGCAGGCCAAGCCCGACCTGATCCTCCTGGACG
TCATGCTGCCCGACGCCGATGGCTTCGAGCTCTGCCGCCAGATCCGCCACTCTTCGGCGCTCTCCCGCACCCCGGTCCTC
TTCCTGACCGCCCGCTCCGATGAGGTGGACCGCGTCCTCGGCCTCGAGATCGGCGGCGACGACTACATGACCAAGCCTTT
CAGCCCCCGCGAGCTGATCGCGCGCGTCAAGGCCCACCTGCGCCGCGAGGAGATGGATGCCGAGCCCGGTGCGGTCGGCA
TCGGCCCCTTCCGGCTCGATCGCACCGCCCGCCGCGTCTACCTGAACGGCCGCGAGATCTCCCTGACTTCCACCGAGTTC
AACCTCCTCGAGTACTTCCTCACTCATCCCGGTCGCGCCTACAGCCGCGACCAGCTGCTCGAGGCGGTGTGGGGCGAACA
GCGCTACGTCACCCCGCGCACCGTGGATGTCCATGTCCGTCGCCTTCGCGAGCAGATCGAAGAACAGCCCGATGCGCCGC
GCTACCTGACCACCGTCCGCGGTTTCGGGTATCGTTTCGAAGAGGGCACATGA

Protein sequence :
MPKKIAIVEDEAELASLIEYNLTRHGYETQILGGGTGTMRALEQAKPDLILLDVMLPDADGFELCRQIRHSSALSRTPVL
FLTARSDEVDRVLGLEIGGDDYMTKPFSPRELIARVKAHLRREEMDAEPGAVGIGPFRLDRTARRVYLNGREISLTSTEF
NLLEYFLTHPGRAYSRDQLLEAVWGEQRYVTPRTVDVHVRRLREQIEEQPDAPRYLTTVRGFGYRFEEGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acid_6282 YP_827493.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-42 45
Acid_6282 YP_827493.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-41 45
Acid_6282 YP_827493.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-46 45
Acid_6282 YP_827493.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-42 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-42 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-48 44
Acid_6282 YP_827493.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 44
Acid_6282 YP_827493.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-47 43
Acid_6282 YP_827493.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-44 42
Acid_6282 YP_827493.1 two component transcriptional regulator BAC0039 Protein 8e-37 42
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002695.1.916589.p Protein 7e-37 42
Acid_6282 YP_827493.1 two component transcriptional regulator CP000034.1.gene2186. Protein 8e-37 42
Acid_6282 YP_827493.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-38 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-31 41
Acid_6282 YP_827493.1 two component transcriptional regulator CP004022.1.gene1676. Protein 1e-36 41
Acid_6282 YP_827493.1 two component transcriptional regulator BAC0596 Protein 4e-37 41
Acid_6282 YP_827493.1 two component transcriptional regulator CP000647.1.gene2531. Protein 7e-37 41
Acid_6282 YP_827493.1 two component transcriptional regulator CP001138.1.gene2239. Protein 4e-37 41
Acid_6282 YP_827493.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acid_6282 YP_827493.1 two component transcriptional regulator VFG1702 Protein 7e-39 41