Gene Information

Name : Arth_4535 (Arth_4535)
Accession : YP_829285.1
Strain :
Genome accession: NC_008537
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 157951 - 158634 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mpa:MAP1102c two-component response regulator

DNA sequence :
ATGCGGGTTCTGCTGGTCGAGGACGAAAAGATGCTGGCCGAGACGGTCCGGCGCGGGCTGGTCAACGAGGGGTTCGTGGT
GGATGTCACCCATGATGGTGTCAGTGGTTTGTGGGCTGCGACGGAGAACCCGTACGACGTGATTTTGTTGGATCTGATGC
TTCCGCTCAAGAACGGTTACGACGTTCTGAAGGAGTTGCGGGAGCGGCTGGTCTGGACCCCGGTGCTGATGCTGACGGCC
AAGGACGGGGAATACGACCAGACGGACGCCTTCGATCTGGGAGCTGATGATTACCTGACCAAGCCTTTCAGCTTTATCGT
CCTCGTTGCCCGGATCCGTGCCCTGATCCGGCGGGGCGCGCCGGAGCGGCCTGTCACCCTCACGGTGGGTTCGCTGACGT
TGGACCCGGGCAGCCGCAGCGTGCGCCGGGGCGATACCGTCATCGAACTGACGGCCCGGGAGTACGGTCTGCTGCATTAC
CTGATGCGCAGCCATGGCCAGGTCGTGTCCAAAGCCCAGATCCTCGACAACGTCTGGGATCCGGCGTTTGAAGGCGGCGA
CAACGTGGTGGAGGTCTATATCGGCTACCTGCGGCGCAAGATCGATGTCCCGTTCGGGCTGCAGACCTTGGCCACGGTCC
GGGGCATGGGGTACATGCTGGGCGCCGACCGGCCGGCCGGGTGA

Protein sequence :
MRVLLVEDEKMLAETVRRGLVNEGFVVDVTHDGVSGLWAATENPYDVILLDLMLPLKNGYDVLKELRERLVWTPVLMLTA
KDGEYDQTDAFDLGADDYLTKPFSFIVLVARIRALIRRGAPERPVTLTVGSLTLDPGSRSVRRGDTVIELTAREYGLLHY
LMRSHGQVVSKAQILDNVWDPAFEGGDNVVEVYIGYLRRKIDVPFGLQTLATVRGMGYMLGADRPAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0125 Protein 7e-46 49
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0197 Protein 2e-42 45
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0083 Protein 1e-39 44
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0111 Protein 1e-39 43
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0308 Protein 3e-39 43
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0638 Protein 5e-32 43
Arth_4535 YP_829285.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-32 42
Arth_4535 YP_829285.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-23 42
Arth_4535 YP_829285.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 9e-30 42
Arth_4535 YP_829285.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 4e-25 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-33 41
Arth_4535 YP_829285.1 two component transcriptional regulator CP000647.1.gene4257. Protein 3e-26 41
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0533 Protein 3e-26 41
Arth_4535 YP_829285.1 two component transcriptional regulator BAC0347 Protein 6e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arth_4535 YP_829285.1 two component transcriptional regulator VFG0596 Protein 2e-37 42
Arth_4535 YP_829285.1 two component transcriptional regulator VFG1389 Protein 3e-34 42
Arth_4535 YP_829285.1 two component transcriptional regulator VFG1386 Protein 4e-35 41