Gene Information

Name : Bcen2424_6268 (Bcen2424_6268)
Accession : YP_839893.1
Strain :
Genome accession: NC_008544
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 446614 - 447333 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bcn:Bcen_1561 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACCAACCGAAACGCATCCTGATCGTCGAGGACGACGCCGACATCGCCGACGTGCTGAGCCTGCACCTGCGCGACGA
GCGCTACGAGGTCGTGCACAGCGCGGACGGCGCCGAAGGGTTGCGCCTGCTCGAACAGGGCAACTGGGACGCGCTGATCC
TCGACCTGATGCTGCCGGGCGTCGACGGCCTCGAAATCTGCCGGCGGGCGCGGGCGATGACGCGCTATACGCCGATCATC
ATCACGAGCGCGCGGTCGAGCGAGGTGCATCGAATCCTCGGCCTCGAACTCGGCGCCGACGACTACCTCGCGAAACCGTT
CTCGGTGCTCGAACTTGTCGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGATGCGCTCGCACGCGATTCGCGGATCGACG
CGGGCACGCTCGACGTCGCGGGGCTGGCGATCGATCCGATCGCACGCGAGGCGAGCGTCGACGGCGCACGCCTCGACCTG
ACGCCGCGCGAATTCGACCTGCTGTATTTCTTCGCGCGGCACCCAGGCAAGGTGTTCTCGCGGATGGACCTGCTGAACGC
TGTGTGGGGCTATCAGCACGAAGGCTACGAACATACGGTCAACACCCACATCAACCGGCTGCGCGCGAAGATCGAGGCCG
ATCCGGCCGAGCCGGTGCGCATCCTCACCGTGTGGGGGCGCGGCTACAAGCTCGCCGCGCCGGGCCAGCGGGACGCGTGA

Protein sequence :
MDQPKRILIVEDDADIADVLSLHLRDERYEVVHSADGAEGLRLLEQGNWDALILDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDALARDSRIDAGTLDVAGLAIDPIAREASVDGARLDL
TPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAEPVRILTVWGRGYKLAAPGQRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-71 62
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-71 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-43 46
Bcen2424_6268 YP_839893.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-38 44
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-36 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-31 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-34 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-41 43
Bcen2424_6268 YP_839893.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-42 42
Bcen2424_6268 YP_839893.1 two component transcriptional regulator BAC0596 Protein 6e-31 42
Bcen2424_6268 YP_839893.1 two component transcriptional regulator BAC0039 Protein 6e-32 42
Bcen2424_6268 YP_839893.1 two component transcriptional regulator CP001138.1.gene2239. Protein 6e-31 42
Bcen2424_6268 YP_839893.1 two component transcriptional regulator CP000034.1.gene2186. Protein 6e-32 42
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_002695.1.916589.p Protein 6e-32 42
Bcen2424_6268 YP_839893.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-38 41
Bcen2424_6268 YP_839893.1 two component transcriptional regulator AM180355.1.gene1830. Protein 3e-38 41
Bcen2424_6268 YP_839893.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-39 41
Bcen2424_6268 YP_839893.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-31 41
Bcen2424_6268 YP_839893.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_6268 YP_839893.1 two component transcriptional regulator VFG1563 Protein 2e-71 62
Bcen2424_6268 YP_839893.1 two component transcriptional regulator VFG1702 Protein 2e-71 62
Bcen2424_6268 YP_839893.1 two component transcriptional regulator VFG1389 Protein 3e-31 46