Gene Information

Name : Sfum_2007 (Sfum_2007)
Accession : YP_846125.1
Strain : Syntrophobacter fumaroxidans MPOB
Genome accession: NC_008554
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2457532 - 2458203 bp
Length : 672 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: gsu:GSU0451 DNA-binding response regulator

DNA sequence :
ATGCGGCTCCTGGTGGTGGAAGACGAGAAGAAAGTCGCGAGCTTTATCCGTAAAGGGCTGGAAGAAGAGGGTTATGCGGT
GGACGTGGCCCTGGACGGCGAGGTTGGCCTCCAGATGGCCATGGACCGGGTGCACGATCTGATCATCCTGGACATCCAGC
TTCCGCGCCTGAGCGGAATGGAACTGCTCCGGTCGCTGCGCGCAAAACGGATTTCGACGCCTGTCCTGCTGCTCACCGTG
AGGGCGACCATCGAAGACAAGGTCCTCGGTCTGGATGCTGGCGCCGACGACTACCTGACCAAGCCCTTCTCTTTCCGCGA
ACTGGTCGCGCGGGTGCGCGCCCTGTTGAGGCGCCGGGCGGAAAGCAGTCAGACCGAGCTCCGGGTAGCCGACCTGACGC
TCGATCCGGTCAGGCACACAGTGTCGAGAGGTTCGGAAAAGATCGAGCTCACGGCCAAGGAGTTCGCGCTTCTCGACTAT
TTCATGCGCAATCCGGACCGGGTCCTGACCAGGACCATGATTGCCGAACACGTCTGGGATTATGATTTCGACTCGATGAC
GAATGTCATCGACGTTTACGTGAATTATCTTCGCCGCAAGATCGATTCCGACCGCGAACCGAAGCTCATCCATACCGTTC
GCGGGGTCGGCTACATGCTGAAGACGGAGTGA

Protein sequence :
MRLLVVEDEKKVASFIRKGLEEEGYAVDVALDGEVGLQMAMDRVHDLIILDIQLPRLSGMELLRSLRAKRISTPVLLLTV
RATIEDKVLGLDAGADDYLTKPFSFRELVARVRALLRRRAESSQTELRVADLTLDPVRHTVSRGSEKIELTAKEFALLDY
FMRNPDRVLTRTMIAEHVWDYDFDSMTNVIDVYVNYLRRKIDSDREPKLIHTVRGVGYMLKTE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-38 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-37 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0111 Protein 2e-47 55
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0308 Protein 6e-41 53
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0197 Protein 2e-40 53
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0083 Protein 3e-43 50
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0125 Protein 6e-43 49
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0347 Protein 3e-41 49
Sfum_2007 YP_846125.1 two component transcriptional regulator BAC0638 Protein 9e-38 49
Sfum_2007 YP_846125.1 two component transcriptional regulator HE999704.1.gene1528. Protein 7e-37 44
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 43
Sfum_2007 YP_846125.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-29 42
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-26 42
Sfum_2007 YP_846125.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-30 42
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-34 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-34 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-33 41
Sfum_2007 YP_846125.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 4e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfum_2007 YP_846125.1 two component transcriptional regulator VFG1390 Protein 2e-47 51
Sfum_2007 YP_846125.1 two component transcriptional regulator VFG0596 Protein 2e-38 48
Sfum_2007 YP_846125.1 two component transcriptional regulator VFG1386 Protein 2e-39 43
Sfum_2007 YP_846125.1 two component transcriptional regulator VFG1389 Protein 4e-35 43