Gene Information

Name : Sfum_3674 (Sfum_3674)
Accession : YP_847779.1
Strain : Syntrophobacter fumaroxidans MPOB
Genome accession: NC_008554
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4483027 - 4483818 bp
Length : 792 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: hch:HCH_00579 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCCACGGGGATGGAATACGGGGCGGGCGGTATTTGCATTCGGACGGTTCGATGTTTTCATTGTACAAATCTTTCCGAG
CGGAACGATTTCCATGCGTGTTTTGGTGGTTGAAGACGACAGACAGATCACGGATTTCCTTGAACGGGCGTTGACCGAGG
CCGGCTTCAAGATCGATGTGGCCTGGAACGGCCCGCAAGGATTTGAACTCGCGCTCAAGGAAAGCTACGACGCCATCATC
ATCGACGTCATCCTTCCCGTAATGGACGGTCTGGAGATCCTTCAGAAGCTTCGCAATCGCGGGATCCTGACGCCCGTGCT
GATCCTGAGCGCAAAGGGCAGTGTGAGCGACCGGGTGAGCGGCCTGGAGCTCGGGGGAGACGACTACCTCACCAAGCCCT
TTGAACTGGCCGAGCTTCTCGCGAGGGTCTGGAGCCTCATCCGTCGAAGCAAGGTGAACCAGGAGACGGTGCAGCTCAAG
GCCGGCGACCTGTGGCTGGACCTGGTCAGCCGCCGCGTTTTCCGCGGTGACGAGGAGTTCCGGCTGCTGCCCCAGGAATT
CGCCCTGCTCGAATACCTGATGCGCAACAAGGGAAGGGTGGTCACGCGCGCGGAGATTCTCGAGAACGTCTGGGGCTATA
ACTTCGTGCCCGCCACGAATGTCGTGGAAGTTCACATCTGCCGGCTGCGCGAGAAACTGGAACGTCCGAACAAGCCCAGA
CTCCTGCAGACTTTCCGCAAGGCCGGTTATGCCCTGGTCGAAGACAGCTCGCCGGGGGACAAGGAATCATAG

Protein sequence :
MPRGWNTGRAVFAFGRFDVFIVQIFPSGTISMRVLVVEDDRQITDFLERALTEAGFKIDVAWNGPQGFELALKESYDAII
IDVILPVMDGLEILQKLRNRGILTPVLILSAKGSVSDRVSGLELGGDDYLTKPFELAELLARVWSLIRRSKVNQETVQLK
AGDLWLDLVSRRVFRGDEEFRLLPQEFALLEYLMRNKGRVVTRAEILENVWGYNFVPATNVVEVHICRLREKLERPNKPR
LLQTFRKAGYALVEDSSPGDKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0197 Protein 9e-41 48
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0083 Protein 1e-45 48
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0125 Protein 4e-47 47
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0638 Protein 1e-39 46
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0347 Protein 3e-44 46
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0111 Protein 9e-47 45
Sfum_3674 YP_847779.1 two component transcriptional regulator BAC0308 Protein 7e-42 44
Sfum_3674 YP_847779.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-41 44
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-39 42
Sfum_3674 YP_847779.1 two component transcriptional regulator NC_012469.1.7686381. Protein 8e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfum_3674 YP_847779.1 two component transcriptional regulator VFG1390 Protein 5e-45 45
Sfum_3674 YP_847779.1 two component transcriptional regulator VFG1389 Protein 7e-36 45
Sfum_3674 YP_847779.1 two component transcriptional regulator VFG1386 Protein 2e-38 42
Sfum_3674 YP_847779.1 two component transcriptional regulator VFG0596 Protein 1e-34 41