Gene Information

Name : Shewana3_4343 (Shewana3_4343)
Accession : YP_863856.1
Strain :
Genome accession: NC_008573
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 229627 - 229902 bp
Length : 276 bp
Strand : +
Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: sty:HCM1.153 putative mercuric transport protein periplasmic binding protein

DNA sequence :
ATGAAAAAACTGTTTGCCGCCCTCGCCCTCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTCACGCTGTC
CGTGCCTGGCATGACCTGCGCCTCTTGCCCGATCACTGTCAAGCACGCGCTTTCCAAGGTTGAGGGCGTGAGCAAGACCG
ACGTAAGTTTCGACAAGCGCCAGGCCGTCGTCACCTTCGACGATGCCAAGACCAACGTCCAGAAGTTGACCAAGGCGACC
GAGGACGCGGGCTATCCGTCCAGCCTCAAACGCTGA

Protein sequence :
MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCASCPITVKHALSKVEGVSKTDVSFDKRQAVVTFDDAKTNVQKLTKAT
EDAGYPSSLKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-27 100
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-27 100
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-23 82
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-23 82
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-23 82
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-23 82
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-23 82
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-23 82
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 8e-22 77
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-23 75

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shewana3_4343 YP_863856.1 mercuric transport protein periplasmic component BAC0679 Protein 7e-24 85
Shewana3_4343 YP_863856.1 mercuric transport protein periplasmic component BAC0678 Protein 1e-23 84
Shewana3_4343 YP_863856.1 mercuric transport protein periplasmic component BAC0231 Protein 8e-24 82
Shewana3_4343 YP_863856.1 mercuric transport protein periplasmic component BAC0675 Protein 4e-22 77
Shewana3_4343 YP_863856.1 mercuric transport protein periplasmic component BAC0674 Protein 3e-17 62