Gene Information

Name : Acel_1832 (Acel_1832)
Accession : YP_873590.1
Strain : Acidothermus cellulolyticus 11B
Genome accession: NC_008578
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2075834 - 2076571 bp
Length : 738 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: nfa:nfa27150 putative two-component system response regulator

DNA sequence :
GTGATCCGCGGAGGCCGGTCAGGCGGCGGGGCGCCATGGCATAGTGGCAGCGTGCCGCGCATTCTCCTCATTGAGGACGA
CGATCGGATCCGTGCCTCGATGCGGTTGGCGTTGACGGACGATGGCCATGAGGTCATCGAGGCGCCGTCCGGTGCGGCGG
GTCTGGAATTGTTCGGCGCCGGGGGAGCTGACGTCGTCCTGGTTGACCTCATGCTGCCGGATATCGACGGATTCGAATGC
TGCCGGCGGCTGCGTCGCAGCAGTGACGTGCCCATCATCATGGTGACCGCCCGTACGGACACCCACGACGTCGTCGCCGG
CCTGGAAGCCGGCGCCGACGATTACGTGACAAAACCCTTTGAAATGAAGGAGCTCTCCGCCCGGATCCGGGCGTTGCTGC
GCCGCAGCCGGTCCGCGGGCGGCCCGGCGGGCGAGGTCATCGACATCCAGGATTTGGAAATCCGCCCGGACGCCGGAGTG
GTGCGGCGCAACGGTGAGGCACTGCACCTGACCCGCACGGAATTTCGGTTGTTGTGCGAGCTTGCGTCGGCGCCCGATCG
GGTGTACAGCCGGGAACAGCTGCTGGAGAGGGTGTGGGGCTACGACTACTTTGGCGACGGCCGGATCGTCGACGTCCACG
TCCGGCGGTTGCGCACCAAAATTGAAGAGGATCCCGCACATCCGCGTATCCTCGTCACCGTTCGCGGCCTGGGATACAAG
ATTCAACCGGCACCGTGA

Protein sequence :
MIRGGRSGGGAPWHSGSVPRILLIEDDDRIRASMRLALTDDGHEVIEAPSGAAGLELFGAGGADVVLVDLMLPDIDGFEC
CRRLRRSSDVPIIMVTARTDTHDVVAGLEAGADDYVTKPFEMKELSARIRALLRRSRSAGGPAGEVIDIQDLEIRPDAGV
VRRNGEALHLTRTEFRLLCELASAPDRVYSREQLLERVWGYDYFGDGRIVDVHVRRLRTKIEEDPAHPRILVTVRGLGYK
IQPAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acel_1832 YP_873590.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-41 48
Acel_1832 YP_873590.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-42 47
Acel_1832 YP_873590.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-26 42
Acel_1832 YP_873590.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-36 42
Acel_1832 YP_873590.1 two component transcriptional regulator HE999704.1.gene1528. Protein 8e-30 42
Acel_1832 YP_873590.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-30 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 41
Acel_1832 YP_873590.1 two component transcriptional regulator CP000034.1.gene3671. Protein 8e-29 41
Acel_1832 YP_873590.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acel_1832 YP_873590.1 two component transcriptional regulator VFG1389 Protein 2e-23 46
Acel_1832 YP_873590.1 two component transcriptional regulator VFG1702 Protein 3e-30 43
Acel_1832 YP_873590.1 two component transcriptional regulator VFG1390 Protein 2e-30 42
Acel_1832 YP_873590.1 two component transcriptional regulator VFG1563 Protein 7e-30 42