Gene Information

Name : Ppro_2957 (Ppro_2957)
Accession : YP_902612.1
Strain : Pelobacter propionicus DSM 2379
Genome accession: NC_008609
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3228586 - 3229257 bp
Length : 672 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pca:Pcar_3081 response regulator receiver domain protein (CheY-like)

DNA sequence :
ATGAAAATTCTTGTTGTAGAAGATGAAAAAAAAGTTGCCGGCTTTATCAAGCGCGGTCTGGAGGAGGACGATTATTCGGT
CACCATCGTCCATGATGGCGCCGAGGGGCTCAAACAGGCCCAGTCCGGCGAGTACAGCCTGGCGATCCTGGATGTGATGG
TGCCCAAGAAGGATGGACTGACCGTGATCCGGGAACTGCGCGAGGGAGGCAGCCAGATGCCTGTCCTGATGCTGACCGCC
CGGGGAACGACCGATGACATCGTGTCCGGCCTGGAGGCGGGGGCCGATGACTACCTGACCAAGCCCTTCGCCTTTGCCGA
GCTTCTGGCCCGCGTCAGGGCGCTTCTACGCCGTAGCGAGCATGATCGCGGGGCGGAGATCTTCTTCGCCGACCTGCGCC
TCGATCCGGTCTCCCACAAGGTCTGGCGCAGCGGCAACGAGATCGACCTGACCGCCAAGGAGTACGGCCTGCTGGAATAC
CTGGTCCGCAACCCCAACAAGGTGCTCTCCCGCGCCATGATCGCCGAGCATGTCTGGGACTACGCCTTTGACAGCTTCAC
CAACATCATCGATGTGTACGTCAATTATCTGCGCAAGAAGGTGGACAAGGAATACTCCACGAAGCTGATCCACACCGTGC
GCGGCCAGGGGTATATCCTCAGGGAGGGGTAG

Protein sequence :
MKILVVEDEKKVAGFIKRGLEEDDYSVTIVHDGAEGLKQAQSGEYSLAILDVMVPKKDGLTVIRELREGGSQMPVLMLTA
RGTTDDIVSGLEAGADDYLTKPFAFAELLARVRALLRRSEHDRGAEIFFADLRLDPVSHKVWRSGNEIDLTAKEYGLLEY
LVRNPNKVLSRAMIAEHVWDYAFDSFTNIIDVYVNYLRKKVDKEYSTKLIHTVRGQGYILREG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0111 Protein 3e-43 53
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0347 Protein 5e-38 52
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0308 Protein 3e-41 51
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0083 Protein 3e-41 50
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0197 Protein 5e-39 50
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0638 Protein 2e-34 50
Ppro_2957 YP_902612.1 two component transcriptional regulator BAC0125 Protein 2e-40 49
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-31 44
Ppro_2957 YP_902612.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-28 43
Ppro_2957 YP_902612.1 two component transcriptional regulator HE999704.1.gene1528. Protein 5e-33 43
Ppro_2957 YP_902612.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 1e-23 42
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002516.2.879194.p Protein 2e-21 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-33 41
Ppro_2957 YP_902612.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ppro_2957 YP_902612.1 two component transcriptional regulator VFG1390 Protein 6e-47 50
Ppro_2957 YP_902612.1 two component transcriptional regulator VFG0596 Protein 5e-34 47
Ppro_2957 YP_902612.1 two component transcriptional regulator VFG1386 Protein 2e-39 41
Ppro_2957 YP_902612.1 two component transcriptional regulator VFG1389 Protein 4e-33 41