Gene Information

Name : Cpha266_1205 (Cpha266_1205)
Accession : YP_911664.1
Strain : Chlorobium phaeobacteroides DSM 266
Genome accession: NC_008639
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1372996 - 1373664 bp
Length : 669 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cch:Cag_0440 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATTCTTGTTATCGAAGACGAACCGGGAATATCCGGATTTCTCAAGGAGGGACTGGAAGAGGAGTATTTTGCCGT
CGATCTTGCTTTCGACGGCAAAACCGGGCTTGACATGGCGATCCTGAACGAATATGATCTCATGATCGTTGACTGGATGA
TTCCCGGAATCAGCGGCATAGAGGTATGCCGACAGGTACGCAAAGCCGGAAGTTCCGTTCCGATCATCTTTTTGACCGCA
AAAGACACCCTTGAGGATATCGTGTTCGGTCTCGATGCAGGAGCAAACGATTATATCAGAAAACCTTTCGCATTCGAGGA
GCTGCTGGCCCGCATACGGGTGCAGCTTCGCCGAAACAATCCGGAAAGCGACGCCATAACGGCTGGATTCGTGACCGTAA
ACCCGGTTACCCACCAGGTATTCTGCAGGGATACAGAAATCGCACTGACCCCCAAGGAATTTTCCCTGCTTGAATTTCTG
GCACGCAACAAGGATAAAGTCTGCACAAGAAGCCGGATCATCGAACATGTCCGGGATATGCATTTCGACTCCGATACATC
GATCATCGATGTCTATATCAATTTCCTTCGAAAGAAACTCGACTGTTCAGGATGCGGAAACATCATTCAAACGATTCGGG
GCGTCGGCTACATTATTCGTGAATCCTGA

Protein sequence :
MRILVIEDEPGISGFLKEGLEEEYFAVDLAFDGKTGLDMAILNEYDLMIVDWMIPGISGIEVCRQVRKAGSSVPIIFLTA
KDTLEDIVFGLDAGANDYIRKPFAFEELLARIRVQLRRNNPESDAITAGFVTVNPVTHQVFCRDTEIALTPKEFSLLEFL
ARNKDKVCTRSRIIEHVRDMHFDSDTSIIDVYINFLRKKLDCSGCGNIIQTIRGVGYIIRES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-43 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0638 Protein 5e-35 46
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0111 Protein 5e-40 45
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0125 Protein 6e-38 44
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0083 Protein 1e-38 44
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0308 Protein 1e-36 43
Cpha266_1205 YP_911664.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-37 42
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0347 Protein 7e-34 42
Cpha266_1205 YP_911664.1 two component transcriptional regulator BAC0197 Protein 2e-35 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpha266_1205 YP_911664.1 two component transcriptional regulator VFG1390 Protein 1e-45 44
Cpha266_1205 YP_911664.1 two component transcriptional regulator VFG0596 Protein 3e-35 43