Gene Information

Name : Noca_2032 (Noca_2032)
Accession : YP_923228.1
Strain : Nocardioides sp. JS614
Genome accession: NC_008699
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2176326 - 2176646 bp
Length : 321 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: cef:CE2618 putative transposase

DNA sequence :
ATGCGAACCATGCCGAAGAAGATCGATCCCGCAGTCAAGGAGCGGTGCGTGCGGCAGGTGCTGGAGCACCTGCCGGAGTA
CCCGTCGCTGACCGCGGCCGCCGAGTCCGTCGCACGCCGCGAAGGCCTCGGGAAGGAGACCGTGCGCCGGTGGGTCGTCC
AGGCCCAGATCGACGGCGGCCAGCGCCAGGGCGCAACCAGCGAGGAGCTCGCTGAGATCAAGGAGCTCAAAGCCAAGGTC
CGTCGGCTCGAGGAAGACAACGAGATCCTCCGCCGGGCCTCAATTTTCTTCGCGGGGGAACTCGACCCCCGCAATCGCTG
A

Protein sequence :
MRTMPKKIDPAVKERCVRQVLEHLPEYPSLTAAAESVARREGLGKETVRRWVVQAQIDGGQRQGATSEELAEIKELKAKV
RRLEEDNEILRRASIFFAGELDPRNR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 0.011 44
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 0.007 44
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 3e-05 43
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 3e-05 43
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 0.011 43
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 0.001 43
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 0.001 43
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 0.001 43
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 3e-05 43
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 3e-05 43
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 0.004 42
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 0.003 42
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 0.004 42
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 0.003 42
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 3e-05 42
unnamed AAF09023.1 unknown Not tested SHI-O Protein 0.010 42
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 0.009 42
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 3e-05 42
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 0.010 42
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 0.009 42
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 3e-05 42
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 4e-05 42
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 0.009 42
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 3e-05 42
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 0.006 42
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 0.009 42
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 0.006 42
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 0.004 42
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 1.00 41
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 0.010 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Noca_2032 YP_923228.1 transposase IS3/IS911 family protein VFG1603 Protein 0.005 43
Noca_2032 YP_923228.1 transposase IS3/IS911 family protein VFG0643 Protein 0.003 42
Noca_2032 YP_923228.1 transposase IS3/IS911 family protein VFG1717 Protein 0.001 42
Noca_2032 YP_923228.1 transposase IS3/IS911 family protein VFG0606 Protein 0.003 41