Gene Information

Name : Mkms_4387 (Mkms_4387)
Accession : YP_940368.1
Strain : Mycobacterium sp. KMS
Genome accession: NC_008705
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4608016 - 4608708 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_4301 two component transcriptional regulator, winged helix family

DNA sequence :
GTGCCTGTGCGCATACTTGTCGTCGACGACGATCGCGCGGTGCGAGAATCCCTGCGCCGGTCCCTGTCCTTCAACGGATA
TTCGGTCGAGTTGGCCCAGGACGGTGTCGAAGCTCTCGACCTGATCGCCAACAACCGGCCCGACGCCGTGGTGCTGGACG
TGATGATGCCCCGGCTCGACGGCCTCGAGGTGTGCCGGCAGCTTCGCAGCACCGGCGACGACCTGCCGATCCTGGTGCTG
ACGGCCCGTGACTCGGTGTCCGAGCGGGTCGCCGGACTCGATGCCGGCGCCGACGACTACCTGCCCAAACCGTTCGCGCT
CGAGGAACTGCTCGCGCGGATGCGGGCCCTGCTGCGCCGCACCTCCCCCGACGAGGGCCCCGATTCCCCGGCGCTGACCT
TTCTCGATCTGACCCTGGACCCGGTCACCCGCGAGGTGACCCGCGGGTCCCGGCAGATCAGCCTCACCCGCACCGAGTTC
GCGTTGCTGGAGATGCTGATCGCCAATCCGCGCCGCGTGCTCACCCGCAGCCGCATCCTCGAGGAAGTGTGGGGCTTCGA
CTTCCCGACCTCGGGGAACGCGCTCGAGGTGTACATCGGCTATCTGCGCCGGAAGACCGAAGCGTCCGGGGAGCCGCGAC
TGATCCACACCGTGCGCGGTGTGGGGTACGTGCTCCGCGAGACGCCCCCCTGA

Protein sequence :
MPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVCRQLRSTGDDLPILVL
TARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTSPDEGPDSPALTFLDLTLDPVTREVTRGSRQISLTRTEF
ALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEASGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mkms_4387 YP_940368.1 two component transcriptional regulator BAC0083 Protein 1e-32 46
Mkms_4387 YP_940368.1 two component transcriptional regulator BAC0125 Protein 3e-34 44
Mkms_4387 YP_940368.1 two component transcriptional regulator HE999704.1.gene1528. Protein 9e-39 44
Mkms_4387 YP_940368.1 two component transcriptional regulator BAC0308 Protein 1e-33 43
Mkms_4387 YP_940368.1 two component transcriptional regulator BAC0111 Protein 1e-34 43
Mkms_4387 YP_940368.1 two component transcriptional regulator BAC0638 Protein 4e-27 43
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-33 42
Mkms_4387 YP_940368.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 42
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-33 41
Mkms_4387 YP_940368.1 two component transcriptional regulator AE015929.1.gene1106. Protein 9e-30 41
Mkms_4387 YP_940368.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-24 41
Mkms_4387 YP_940368.1 two component transcriptional regulator BAC0197 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mkms_4387 YP_940368.1 two component transcriptional regulator VFG1390 Protein 9e-87 91
Mkms_4387 YP_940368.1 two component transcriptional regulator VFG1389 Protein 5e-43 52
Mkms_4387 YP_940368.1 two component transcriptional regulator VFG1386 Protein 2e-44 51
Mkms_4387 YP_940368.1 two component transcriptional regulator VFG0596 Protein 4e-33 42