Gene Information

Name : Ping_1264 (Ping_1264)
Accession : YP_942692.1
Strain : Psychromonas ingrahamii 37
Genome accession: NC_008709
Putative virulence/resistance : Resistance
Product : stress protein, tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1571949 - 1572524 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: sco:SCO0641 tellurium resistance protein

DNA sequence :
ATGGCTGTTTCTCTACAAAAAGGCGGAAATGTTTCACTAGATAAAGTTGCGCCAGGTATGACTAAATGTCTACTCGGTTT
AGGTTGGGATTCAAGAAGTACTGATGGAACTGATTTTGACTTAGATGCATCTGGCTTTATGGTTAATGCAGAAGGTAAAG
TACTTTCAGATAAAGGTTTTATTTTTTACGGTAACTTAGTTTCTGAGTGTAGTTCTGTTGAACATACTGGTGATAACTTA
ACCGGCGAAGGCGAGGGTGATGACGAAGCGATTAAAATTAATTTAAGCAAAGTCCCTGCTGATGTTGTGAGAATTGTTAT
TGGTGTAACGATTCACGAAGCTGAATCACGTAAACAAAATTTTGGTCAAGTTTCTAATGCTTTCATTCGAGTTGTTAATG
AAGAGAACAACGAGGAAGTTGCCCGTTACGATTTAACGGAAGACTATTCTACTGAAACGGCACTGCTTTTCGGTGAAATG
TATCGCCACAATGGTGCATGGAAATTTAAAGCTGTGGGTCAAGGTTTTGCCGGCGGCTTAAAAGCAATGGCGCAACAATT
TAATGTTAATGTTTAA

Protein sequence :
MAVSLQKGGNVSLDKVAPGMTKCLLGLGWDSRSTDGTDFDLDASGFMVNAEGKVLSDKGFIFYGNLVSECSSVEHTGDNL
TGEGEGDDEAIKINLSKVPADVVRIVIGVTIHEAESRKQNFGQVSNAFIRVVNEENNEEVARYDLTEDYSTETALLFGEM
YRHNGAWKFKAVGQGFAGGLKAMAQQFNVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 67
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-52 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-56 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-53 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ping_1264 YP_942692.1 stress protein, tellurium resistance protein BAC0390 Protein 3e-55 66
Ping_1264 YP_942692.1 stress protein, tellurium resistance protein BAC0389 Protein 8e-56 66