Gene Information

Name : Ping_1266 (Ping_1266)
Accession : YP_942694.1
Strain : Psychromonas ingrahamii 37
Genome accession: NC_008709
Putative virulence/resistance : Resistance
Product : stress protein, tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1573363 - 1573941 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: ecs:ECs1355 putative tellurium resistance protein TerD

DNA sequence :
ATGGCAGTTTCTTTGCAAAAAGGCGGTAACGTCTCTTTAGAAAAAATAGCGCCCTCCATGCAGAATTGCTTGCTTGGTTT
GGGATGGGATGCAAATTCAATGAATGGTCATGATTTTGATCTAGACGCATCTGCATTTATGCTTAATTCAGAAAATAAAA
TTCTTTCTGATTCTCATTTTATTTTCTATGGTCAATTGTTATCTCCATGCCAATCTATTGAACACACGGGTGATAATTTA
ACCGGTGAGGGTGACGGAGATGATGAATCCATTAAAGTGGACTTAGGCGCAGTGCCTGCCGAGGTTGCTAAAATTGTTGT
CGGTGTCACTATTCATGAAGCAGAGAAACGCCATCAAAATTTCGGGCAGGTTTCAAATGCATTTATGCGTTTAATAGATG
AAAGCAATCATCAAGAAGTGGTGCGTTATGATTTATCTGAGGATTATTCCACAGAAACTGCATTAATTTTTGGTGAATTA
TACCGCCATAAAGGAGAGTGGAAATTTAAAGCAATTGGTCAAGGTTACTCAGGTGGACTGCATGCGATGGCAGTCAACTA
TGGGATTAATATTACCTAA

Protein sequence :
MAVSLQKGGNVSLEKIAPSMQNCLLGLGWDANSMNGHDFDLDASAFMLNSENKILSDSHFIFYGQLLSPCQSIEHTGDNL
TGEGDGDDESIKVDLGAVPAEVAKIVVGVTIHEAEKRHQNFGQVSNAFMRLIDESNHQEVVRYDLSEDYSTETALIFGEL
YRHKGEWKFKAIGQGYSGGLHAMAVNYGINIT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-60 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-54 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-54 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-54 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-51 57
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ping_1266 YP_942694.1 stress protein, tellurium resistance protein BAC0389 Protein 3e-59 63
Ping_1266 YP_942694.1 stress protein, tellurium resistance protein BAC0390 Protein 8e-58 63