Gene Information

Name : Maqu_1000 (Maqu_1000)
Accession : YP_958280.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1142312 - 1142617 bp
Length : 306 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: tcx:Tcr_1853 transposase IS3/IS911

DNA sequence :
ATGGCGAAAACTAGAAACTTCAGTCCGGAATTCCGTTTGGAGGCTGCTCAATTGGTGGTCGACCAGGGATACACAGTGAA
AGCTGCCTGCGATGCCATGGGTGTTGGCAAATCCACCATGGAGTACTGGGTTCGTAAACTTCGTTCCGAGCGGGCTGGCA
AGGCACCCAGAGGCGAGGCCCTGACCACAGAGCAGCGTGAAATTCAGGAACTGAAGCGCCGCCTTCGTCGGGCGGATGAA
GAAAAGGAAATCTTAAAAAAGGCTACCGCTCTCTTGATGTCGGACTCCCTGAGCAATTCTCGATAA

Protein sequence :
MAKTRNFSPEFRLEAAQLVVDQGYTVKAACDAMGVGKSTMEYWVRKLRSERAGKAPRGEALTTEQREIQELKRRLRRADE
EKEILKKATALLMSDSLSNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 5e-26 67
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-27 66
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-27 66
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-27 66
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-27 66
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-27 66
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-27 66
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-27 66
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-27 66
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-25 62
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-25 62
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-20 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-23 58
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-23 58
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-23 58
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-23 58
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 5e-24 57
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-24 57
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-21 55
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-20 55
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 4e-12 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 6e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_1000 YP_958280.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-27 66
Maqu_1000 YP_958280.1 transposase IS3/IS911 family protein VFG1485 Protein 2e-25 62
Maqu_1000 YP_958280.1 transposase IS3/IS911 family protein VFG0784 Protein 2e-23 58
Maqu_1000 YP_958280.1 transposase IS3/IS911 family protein VFG1553 Protein 6e-22 55
Maqu_1000 YP_958280.1 transposase IS3/IS911 family protein VFG1566 Protein 2e-12 44
Maqu_1000 YP_958280.1 transposase IS3/IS911 family protein VFG1521 Protein 3e-11 41