Gene Information

Name : Maqu_1007 (Maqu_1007)
Accession : YP_958287.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1148247 - 1148948 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sru:SRU_2488 response regulator DrrA

DNA sequence :
ATGCCGCGCACGGTATTGATAATCGAAGACAATCCCGGTATCGGCGAACTGGTCCGCATGCAGGTATCCGACCTGGGCAT
GACTGCGGTTCTGCGGGACCGGGGCGACAGCGGCCTGGCGCGTTTCCGGGACGGTGGTATTGATCTGGTGATTCTGGACC
TCATGCTTCCGGGCCTGGATGGCCTGGCGGTGTGCCGGGAAATACGCGCCAGTGCGGGTTATGTGCCGGTGCTCATGCTG
ACCGCCAAGAGCACCGAGCTGGACAGGGTGCTGGGGCTGGAAATGGGGGCGGATGACTACCTCACCAAGCCTTTCAGCGT
GGCGGAACTGTCCGCTCGCATCAAAGCTCTGTTCCGGCGCGTGGACGCGCTCTCCCGGAAGAGCTCAGCCGAAGACGATG
TGGCGGAGATTGAGGCGGACGGGCTGCGGATTGATCCGGTTCGGCGCCGGGTGTTCCTGGAGTGCCGCGAGCTCGATCTG
ACCGCCCGTGAGTTCGATCTTCTGTGGCACTTTGCTTCCCATCGTGGCCGGGTTTTCAGCCGGGCCCAATTGCTGGATGC
CGTCTGGGGGTACAATCACGACGGCTACGAGCACACCGTAAACACCCATATCAACCGCCTGCGTAACAAGATTGAGCCCG
ATCCGGCCGAACCGCGTTACGTTCAGACGGTCTGGGGCGTGGGCTATCGGTTTATGGATTAA

Protein sequence :
MPRTVLIIEDNPGIGELVRMQVSDLGMTAVLRDRGDSGLARFRDGGIDLVILDLMLPGLDGLAVCREIRASAGYVPVLML
TAKSTELDRVLGLEMGADDYLTKPFSVAELSARIKALFRRVDALSRKSSAEDDVAEIEADGLRIDPVRRRVFLECRELDL
TAREFDLLWHFASHRGRVFSRAQLLDAVWGYNHDGYEHTVNTHINRLRNKIEPDPAEPRYVQTVWGVGYRFMD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-54 54
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-53 53
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_012469.1.7685629. Protein 6e-45 44
Maqu_1007 YP_958287.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-46 43
Maqu_1007 YP_958287.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-35 43
Maqu_1007 YP_958287.1 two component transcriptional regulator CP000647.1.gene2531. Protein 4e-35 42
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-36 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-36 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-44 41
Maqu_1007 YP_958287.1 two component transcriptional regulator BAC0596 Protein 4e-35 41
Maqu_1007 YP_958287.1 two component transcriptional regulator CP001138.1.gene2239. Protein 4e-35 41
Maqu_1007 YP_958287.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_1007 YP_958287.1 two component transcriptional regulator VFG1563 Protein 1e-54 54
Maqu_1007 YP_958287.1 two component transcriptional regulator VFG1702 Protein 2e-53 53
Maqu_1007 YP_958287.1 two component transcriptional regulator VFG1389 Protein 2e-30 47
Maqu_1007 YP_958287.1 two component transcriptional regulator VFG0596 Protein 1e-26 41