Gene Information

Name : Maqu_1395 (Maqu_1395)
Accession : YP_958669.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1575604 - 1576044 bp
Length : 441 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein, MerR; KEGG: net:Neut_2571 transcriptional regulator, MerR family

DNA sequence :
ATGCCGGATAAAGCGAATTCATTGACCATCGGTGGCCTGGCTAAGGCTGCCAACGTCCATGTCGAGACAATCCGCTATTA
CCAGCGGCGACGTCTAGTACCGGAGCCGGAACGTCCTCCAGGTGGTATTAGGCGCTATGGTCCAGCTGATATCGAGCGGT
TAATGTTCGTGAAAACGGCTCAGCAGCTGGGCTTCAGTCTTGTCGAAATCAGTGACCTGCTACAACTTGAAGATGGCGCT
CACTGCCAGGAGGCCAGCGCTCTGGCCGAGCACAAGTTGCGGGACGTGCGTGAGAAAATCGACCAACTGGGGAGAATCGA
GAAGGTACTGGGCGAGATGGTTGAGCAGTGCCATGCCCATCCGTACAATATTACCTGCCCATTGATTGCATCATTGCATG
AGGGGGCAGTGGGGGGGAACGATCAACGTGAAAGAACATGA

Protein sequence :
MPDKANSLTIGGLAKAANVHVETIRYYQRRRLVPEPERPPGGIRRYGPADIERLMFVKTAQQLGFSLVEISDLLQLEDGA
HCQEASALAEHKLRDVREKIDQLGRIEKVLGEMVEQCHAHPYNITCPLIASLHEGAVGGNDQRERT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-30 65
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-30 65
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-30 62
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-30 62
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-30 62
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-30 62
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-29 61
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-29 61
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-28 59
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 8e-28 58
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-16 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0688 Protein 2e-30 64
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0687 Protein 5e-31 63
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0232 Protein 5e-31 63
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0686 Protein 3e-30 63
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0683 Protein 1e-30 61
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0684 Protein 7e-31 61
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0689 Protein 3e-28 61
Maqu_1395 YP_958669.1 MerR family transcriptional regulator BAC0682 Protein 2e-14 41