Gene Information

Name : Sputw3181_0217 (Sputw3181_0217)
Accession : YP_961623.1
Strain : Shewanella sp. W3-18-1
Genome accession: NC_008750
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 241408 - 242094 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: son:SO4477 transcriptional regulatory protein CpxR

DNA sequence :
ATGAGTCGGATATTATTGATCGATGACGATCTCGGTTTATCGGAATTACTCGGGCAGTTGCTTGAACTGGAAGGCTTTAC
CTTAACGTTAGCCTACGATGGTAAGAAAGGATTAGATCTTGCCCTCACAACCGATTTTGATCTGATTTTACTCGATGTCA
TGTTACCTAAATTAAATGGTTTTGAAGTGCTTCGAGCCCTGCGCCAACATAAACAAACTCCTGTATTGATGCTAACAGCC
CGTGGCGATGAAATAGACCGCGTTGTGGGTCTTGAAATTGGCGCTGATGACTACCTGCCAAAACCCTTTAATGACCGAGA
GTTAATCGCCCGTATTCGTGCAATTATCCGCCGTGCCCATTTAACCGCCCAAGAAATTCATGCGGCGCCAGCCCAAGAGT
TTGGCGATTTGCGTTTAGACCCTTCACGCCAAGAAGCCTACTGTAATGAACAACTGATTATTCTTACGGGAACAGAGTTC
ACGCTATTGCATACCCTAGCATTACACGCTGGTGAGTTAATGAATAAAGAAGAGCTAAATGAAATTGTGCTTGGCAAAAA
ACTTATGCCCTTCGATCGCAGTTTAGATATGCACCTGTCCAATTTACGGAAAAAGCTCCCCGAGCGTAGCGATGGCAGAC
CGAGGGTAAAAACCATCCGAGGTAAAGGTTATATCTGGCTACCATAA

Protein sequence :
MSRILLIDDDLGLSELLGQLLELEGFTLTLAYDGKKGLDLALTTDFDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTA
RGDEIDRVVGLEIGADDYLPKPFNDRELIARIRAIIRRAHLTAQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
TLLHTLALHAGELMNKEELNEIVLGKKLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGKGYIWLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP001138.1.gene4273. Protein 7e-44 62
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-43 61
Sputw3181_0217 YP_961623.1 two component transcriptional regulator BAC0533 Protein 2e-43 61
Sputw3181_0217 YP_961623.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-43 61
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-43 61
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-43 61
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP001485.1.gene721.p Protein 3e-45 59
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-45 58
Sputw3181_0217 YP_961623.1 two component transcriptional regulator CP000675.2.gene1535. Protein 1e-37 54
Sputw3181_0217 YP_961623.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-26 43
Sputw3181_0217 YP_961623.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-27 41
Sputw3181_0217 YP_961623.1 two component transcriptional regulator NC_008702.1.4607594. Protein 8e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sputw3181_0217 YP_961623.1 two component transcriptional regulator VFG0596 Protein 9e-24 41