Gene Information

Name : Pnap_4558 (Pnap_4558)
Accession : YP_973572.1
Strain :
Genome accession: NC_008758
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 123608 - 124288 bp
Length : 681 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pen:PSEEN4285 heavy-metal DNA-binding response regulator CzrR

DNA sequence :
TTGAAGATTTTGGTAATTGAAGACGAGCCCAGAGCGGCCGATTATTTGCGCCAGGGCTTGATGGAAAGCGGCTACGCCGT
GGAGGTTGCCCACAACGGAACGGACGGTTTGCACGCGGCGGTCAATGGCGATCATGGATTGGTGATTCTGGACATCATGC
TGCCCGGCATTGACGGATTTGCCGTGCTGTCGGCGCTGCGTACCTCCCGGCAAATACCCGTTTTGATGCTCACCGCCCGG
GGCAATACCGACGACAAGGTGCGCGGGTTTGATCTGGGCGCGGATGATTACCTGCTCAAGCCTTTTCAGTTTCCTGAACT
GTTGGCCAGGGTGCGCGCCCTGCTCAAACGCGGCCAGCCGGTCGTAAAGGACCCCGTTTTACGGGCTGCCGATCTTGAAA
TTGATCCGGTGCGTCACCGGGCCACGCGCGCCGGCCAGCGGATCGACCTGTCTGCCAAAGAGTTTGCCTTGCTGACCCTG
CTCGCCCAGAGGGCGGGCGAAGTGCTTTCCAGAACCCAGATCGCGTCGCTGGTGTGGGACATCCATTTCGATTCGGACAC
CAATGTGGTCGAAGTGGCGATCCGGCGGCTGCGCGCCAAGATCGACGATCCTTTTGACGACAAACTGATCCACACGGTGC
GCGGCGTGGGTTACGTACTGGAACGCCGGGCGTCGGTGTGA

Protein sequence :
MKILVIEDEPRAADYLRQGLMESGYAVEVAHNGTDGLHAAVNGDHGLVILDIMLPGIDGFAVLSALRTSRQIPVLMLTAR
GNTDDKVRGFDLGADDYLLKPFQFPELLARVRALLKRGQPVVKDPVLRAADLEIDPVRHRATRAGQRIDLSAKEFALLTL
LAQRAGEVLSRTQIASLVWDIHFDSDTNVVEVAIRRLRAKIDDPFDDKLIHTVRGVGYVLERRASV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-59 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-59 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-63 60
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-65 59
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0197 Protein 8e-64 57
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-56 57
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-61 56
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-62 53
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-57 50
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 5e-40 43
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 5e-35 42
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 9e-32 42
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 5e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 8e-39 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 7e-39 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 1e-38 41
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 1e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-60 57
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-42 44
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-37 44
Pnap_4558 YP_973572.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-38 44