Gene Information

Name : Ajs_2725 (Ajs_2725)
Accession : YP_986944.1
Strain : Acidovorax sp. JS42
Genome accession: NC_008782
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2889275 - 2889958 bp
Length : 684 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: tbd:Tbd_1749 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
GTGAAGATATTGATCGTCGAGGACGAACCCAAGACCGGGGCCTACCTGCGCCAGGGATTGAGCGAGGCGGGCTACAGCCC
GGACCTGGTGCCCAATGGCGCCGATGGCCTGCACATGGCCATCCACGGCCAGTACGACCTGGTGATCCTGGATGTCATGC
TGCCGGGCCTGAACGGCTGGCAGGTGCTGCAGTCCCTGCGTGACCGGGGCCTGGAAATGCCCGTGCTGTTCCTGACCGCC
CGCGATCAGGTGGAGGATCGGGTCAAGGGCCTGGAGCTGGGGGCCGACGACTATCTCGTCAAGCCGTTCTCGTTTGCCGA
GCTGCTGGCCAGGGTGCGCATCATCCTGCGCCGCGGCCATGCCGGCAGCGAAGGCAGCACACTGCGCGTGGCCGATCTGG
AGCTGGATCTGCTGCGCCGCCGGGTGTCCCGCAATGGCCGGCGCGTAGACCTGACGGCCAAGGAGTTCGGCCTGCTGGAG
CTGCTGATGCGCCGCCATGGCGAGGTACTGCCGCGCTCGCTCATCGCATCGCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTCATCGAGGTCGCCATGCGCCGCCTGCGCGTGAAGATCGACGAGGGCCATCCGGTCAAGCTCATCCAGACCG
TGCGCGGCATGGGCTATGTGCTGGACGTGCCGGAGGAGGCCTGA

Protein sequence :
MKILIVEDEPKTGAYLRQGLSEAGYSPDLVPNGADGLHMAIHGQYDLVILDVMLPGLNGWQVLQSLRDRGLEMPVLFLTA
RDQVEDRVKGLELGADDYLVKPFSFAELLARVRIILRRGHAGSEGSTLRVADLELDLLRRRVSRNGRRVDLTAKEFGLLE
LLMRRHGEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRVKIDEGHPVKLIQTVRGMGYVLDVPEEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-54 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-69 68
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0638 Protein 5e-64 67
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0083 Protein 5e-70 66
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-65 64
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-65 64
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0125 Protein 8e-66 63
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator BAC0347 Protein 4e-60 61
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 2e-30 42
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 41
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator VFG0596 Protein 8e-56 58
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator VFG1390 Protein 2e-40 46
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-34 44
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-36 43
Ajs_2725 YP_986944.1 two component heavy metal response transcriptional regulator VFG0473 Protein 8e-32 41