Gene Information

Name : spaP (YE3542)
Accession : YP_001007698.1
Strain : Yersinia enterocolitica 8081
Genome accession: NC_008800
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein SpaP
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4790
EC number : -
Position : 3857315 - 3857989 bp
Length : 675 bp
Strand : -
Note : part of a type III secretory system probably involved in invasion into eukaryotic cells

DNA sequence :
ATGATGCCAACGTTACCTGGGGACATTCCCTTACTGGCGATTGTCGCATTTTCTTCACTATTGCCTTTTGTCATCGCGGC
GGGAACGTGCTACCTGAAAATATCAATCGTGCTAATTATGGTGCGCAATGCGATGGGGGTACAACAGGTACCTTCCGGCC
TGGCGCTCAACGGGATAGCGCTGCTGTTGTCACTGTTTGTGATGATGCCGGTGATTCAGGATGTGAATCACTATATGCGC
ACCGAAAAGGTGGATTTTAGCAATGTTGATTCGGTGGATAAATTTATAGATGGGGGGCTGGGTAGTTACACCGCTTATCT
AAAGAAATACTCCGATCCGGAATTACTCAACTTTTTCGAGTCGTTGCAACAAGGGCGTAGTGAAGAGGAATCGATGGCTG
AAGCTGATACTCGCGAGCCAGCGCTGTTTTCCCTGCTGCCTGCTTACGCGTTGAGTGAAATTAAATCAGCGTTCGAAATT
GGTTTTTATATCTATCTACCTTTTGTAGTAATAGACCTGATTATCTCCAGTATTTTACTTGCGTTGGGGATGATGATGAT
GAGCCCGGTTACCATTTCTGTTCCGGTAAAATTGATCTTGTTCGTGGCAATCGACGGTTGGGCGCTGATTTCCAAGGGGT
TGATTATGCAATATATGGAGCTGGCACAGCATTAG

Protein sequence :
MMPTLPGDIPLLAIVAFSSLLPFVIAAGTCYLKISIVLIMVRNAMGVQQVPSGLALNGIALLLSLFVMMPVIQDVNHYMR
TEKVDFSNVDSVDKFIDGGLGSYTAYLKKYSDPELLNFFESLQQGRSEEESMAEADTREPALFSLLPAYALSEIKSAFEI
GFYIYLPFVVIDLIISSILLALGMMMMSPVTISVPVKLILFVAIDGWALISKGLIMQYMELAQH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 4e-49 60
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 4e-49 60
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 3e-51 60
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 3e-49 59
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 3e-49 59
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 2e-49 59
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 7e-50 58
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 2e-46 55
lscR AAO18040.1 LscR Virulence TTSS locus Protein 6e-29 47
escR CAC81847.1 EscR protein Virulence LEE II Protein 4e-28 44
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 5e-28 44
escR CAI43889.1 EscR protein Virulence LEE Protein 4e-28 44
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 9e-27 44
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 4e-28 44
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 9e-27 44
escR AAC38369.1 EscR Virulence LEE Protein 2e-27 44
escR AAC31528.1 L0049 Virulence LEE Protein 4e-28 44
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 4e-28 44
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 6e-28 44
escR AAK26700.1 EscR Virulence LEE Protein 4e-28 44
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 6e-28 44
escR AAL57527.1 EscR Virulence LEE Protein 4e-28 44
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 5e-28 44
unnamed AAL06354.1 EscR Virulence LEE Protein 1e-26 44
hrcR AAT96262.1 HrcR Virulence S-PAI Protein 2e-20 43
hrcR AAT96303.1 HrcR Virulence S-PAI Protein 2e-20 43
hrcR AAT96343.1 HrcR Virulence S-PAI Protein 2e-20 43
hrcR ABA47279.1 HrcR Virulence S-PAI Protein 1e-21 42
hrpW AAB05075.1 HrpW Virulence Hrp PAI Protein 8e-20 42
hrcR ABQ88359.1 HrcR Virulence Hrp PAI Protein 8e-20 42
hrcR AAT96200.1 HrcR Virulence T-PAI Protein 1e-20 41
hrcR AAT96146.1 HrcR Virulence T-PAI Protein 9e-21 41
hrcR AAB06005.2 HrcR Virulence Hrp PAI Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG1773 Protein 5e-85 100
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG0551 Protein 2e-49 60
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG2455 Protein 2e-50 60
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG1012 Protein 2e-45 57
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG0394 Protein 8e-30 45
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG0188 Protein 7e-29 45
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG0715 Protein 1e-27 44
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG0827 Protein 2e-28 44
spaP YP_001007698.1 surface presentation of antigens protein SpaP VFG0044 Protein 1e-23 43