
|
Name : YE3878 (YE3878) Accession : YP_001008023.1 Strain : Yersinia enterocolitica 8081 Genome accession: NC_008800 Putative virulence/resistance : Unknown Product : putative transposase for insertion sequence element IS1666 Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 4231986 - 4232285 bp Length : 300 bp Strand : - Note : Similar to many transposases including: Yersinia enterocolitica IS1329 transposase A SWALL:Q9X9I2 (EMBL:AJ132945) (110 aa) fasta scores: E(): 1.4e-10, 40.2 id in 97 aa and Shigella dysenteriae transposase InsN for insertion sequence element IS911 InsN SWA DNA sequence : ATGACCAAATATTTTACGGCTGAATTTAAACTCGAAGCAGCAAAGTTGGTTGTTGACCAGAAATACTCTCATTCGGAGGC CGCTAAAGCCATGAATGTCAGTCTTTCCGCCCTTAGCCGATGGGTGGGTAAGCTCAGATTGGAACGTCAGGGTAAAACCC CCGTTGGGCTTCCACTGACGCCTGAACAAATAGAACTTCGGGAAATGAAGAAAAGGATTCAACGTCTTGAAATGGAGAAC GAAATTCTAAAAAAGGCCACCGCTCTCTTGATGTCGGACTCGTTGAACAGTTCGCGATAG Protein sequence : MTKYFTAEFKLEAAKLVVDQKYSHSEAAKAMNVSLSALSRWVGKLRLERQGKTPVGLPLTPEQIELREMKKRIQRLEMEN EILKKATALLMSDSLNSSR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 3e-35 | 85 |
| l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 8e-29 | 70 |
| orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 8e-29 | 70 |
| orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 8e-26 | 69 |
| VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 8e-26 | 69 |
| orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 8e-26 | 69 |
| unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 8e-26 | 69 |
| orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 8e-26 | 69 |
| orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 8e-26 | 69 |
| VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-25 | 69 |
| orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-25 | 69 |
| insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 1e-27 | 68 |
| api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 2e-23 | 64 |
| ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 5e-22 | 59 |
| aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 4e-22 | 59 |
| RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 4e-20 | 58 |
| unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 1e-20 | 58 |
| Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 2e-20 | 58 |
| ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 2e-20 | 58 |
| unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 1e-20 | 58 |
| unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-10 | 44 |
| trp1329A | CAB46577.1 | IS1329 transposase A | Not tested | HPI | Protein | 6e-16 | 44 |
| tnpA | CAB61575.1 | transposase A | Not tested | HPI | Protein | 2e-15 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| YE3878 | YP_001008023.1 | putative transposase for insertion sequence element IS1666 | VFG1553 | Protein | 1e-35 | 85 |
| YE3878 | YP_001008023.1 | putative transposase for insertion sequence element IS1666 | VFG1485 | Protein | 3e-29 | 70 |
| YE3878 | YP_001008023.1 | putative transposase for insertion sequence element IS1666 | VFG1123 | Protein | 3e-26 | 69 |
| YE3878 | YP_001008023.1 | putative transposase for insertion sequence element IS1666 | VFG0784 | Protein | 5e-21 | 58 |
| YE3878 | YP_001008023.1 | putative transposase for insertion sequence element IS1666 | VFG1566 | Protein | 9e-11 | 44 |