Gene Information

Name : P9515_01621 (P9515_01621)
Accession : YP_001010478.1
Strain : Prochlorococcus marinus MIT 9515
Genome accession: NC_008817
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : 3.1.1.61
Position : 149479 - 150225 bp
Length : 747 bp
Strand : +
Note : COG745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]

DNA sequence :
ATGGCTGTATCTAGTCAAACTAAAGAAACAATTCTTGTCGCTGATGACGAGGCAAGCATTAGAAGAATTCTCGAGACTCG
TCTCTCAATGATTGGTTACAAAGTGGTAACTGCTTGTGATGGTAAGGAAGCATTAAAATTATTCAAAGATTATGACCCTG
ATTTGGTTGTCCTTGATGTGATGATGCCAAAATTAGACGGATATGGAGTCTGTCAAGAATTAAGGAAAGATTCAGATGTA
CCCATAGTTATGTTGACTGCATTAGGTGATGTTGCAGATAGAATTACAGGATTAGAATTAGGTGCTGATGATTATGTTGT
CAAACCATTTAGTCCGAAAGAGTTAGAAGCTAGAATTCGATGTGTATTAAGACGAATAGATAAAGAACAACTTCCTGGAA
TGCCAAATTCAGGGTTGATTTTGGTTACGGATATTAAAATTGATACAAATCGAAGACAAGTTTTTAAAAGTGATGAAAGG
ATAAGATTAACTGGCATGGAATTTAGTCTCTTAGAGCTTTTAGTCAGTCGCTCAGGAGAGCCATTTAGTCGCGGAGAGAT
TTTGAAAGAAGTTTGGGGCTATACACCTGAAAGACATGTAGATACGAGAGTAGTGGATGTTCACATATCGCGATTAAGGT
CAAAATTAGAAGCTGATCCTGCAAATCCAGAATTAATTCTTACAGCAAGAGGAACAGGATATCTTTTTCAGAGAATAGTT
GATATATCTCCATTTGACGGTAAATAG

Protein sequence :
MAVSSQTKETILVADDEASIRRILETRLSMIGYKVVTACDGKEALKLFKDYDPDLVVLDVMMPKLDGYGVCQELRKDSDV
PIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRRIDKEQLPGMPNSGLILVTDIKIDTNRRQVFKSDER
IRLTGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEADPANPELILTARGTGYLFQRIV
DISPFDGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
P9515_01621 YP_001010478.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_002745.1124361.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_009782.5559369.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_002951.3237708.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_002758.1121668.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_009641.5332272.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_013450.8614421.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_007793.3914279.p0 Protein 4e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-42 47
P9515_01621 YP_001010478.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-42 47
P9515_01621 YP_001010478.1 two-component response regulator AE000516.2.gene3505. Protein 2e-40 46
P9515_01621 YP_001010478.1 two-component response regulator HE999704.1.gene2815. Protein 5e-40 46
P9515_01621 YP_001010478.1 two-component response regulator BAC0125 Protein 1e-36 45
P9515_01621 YP_001010478.1 two-component response regulator NC_012469.1.7685629. Protein 1e-39 44
P9515_01621 YP_001010478.1 two-component response regulator CP001918.1.gene5135. Protein 2e-23 43
P9515_01621 YP_001010478.1 two-component response regulator CP000034.1.gene3671. Protein 2e-37 43
P9515_01621 YP_001010478.1 two-component response regulator CP004022.1.gene3215. Protein 1e-31 42
P9515_01621 YP_001010478.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-34 41
P9515_01621 YP_001010478.1 two-component response regulator BAC0083 Protein 5e-32 41
P9515_01621 YP_001010478.1 two-component response regulator NC_002695.1.915041.p Protein 6e-25 41
P9515_01621 YP_001010478.1 two-component response regulator BAC0638 Protein 1e-26 41
P9515_01621 YP_001010478.1 two-component response regulator BAC0197 Protein 1e-31 41
P9515_01621 YP_001010478.1 two-component response regulator CP000034.1.gene3834. Protein 6e-25 41
P9515_01621 YP_001010478.1 two-component response regulator CP001138.1.gene4273. Protein 3e-25 41
P9515_01621 YP_001010478.1 two-component response regulator AE016830.1.gene1681. Protein 3e-38 41
P9515_01621 YP_001010478.1 two-component response regulator NC_012469.1.7686381. Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
P9515_01621 YP_001010478.1 two-component response regulator VFG1390 Protein 1e-36 43
P9515_01621 YP_001010478.1 two-component response regulator VFG1389 Protein 2e-30 43
P9515_01621 YP_001010478.1 two-component response regulator VFG0596 Protein 3e-32 41