Gene Information

Name : NATL1_02061 (NATL1_02061)
Accession : YP_001014035.1
Strain : Prochlorococcus marinus NATL1A
Genome accession: NC_008819
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : 3.1.1.61
Position : 192311 - 193057 bp
Length : 747 bp
Strand : +
Note : COG745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]

DNA sequence :
ATGACGGCCACAAGTCCCTCAAAGGAAACCATCCTCGTAGCTGATGATGAGGCAAGCATTAGGAGGATTCTAGAAACTCG
CCTATCCATGATTGGCTATCAGGTAGTTACTGCTTGTGATGGAAATGAGGCTTTGGATCTTTTCAGGAATTGTGAGCCTG
ATTTGGTGGTACTCGATGTCATGATGCCTAAATTAGATGGATATGGAGTTTGCCAGGAACTAAGAAAGGAATCAGATGTT
CCAATAGTTATGCTGACAGCCTTGGGAGATGTTGCAGATAGAATTACAGGACTAGAGCTAGGTGCTGATGATTATGTTGT
TAAACCATTTAGCCCAAAAGAATTAGAAGCTAGGATCAGATGTTTATTAAGAAGGGTAGAGAAAGAACAAATAGCAGGAC
TGCCTAATTCAGGTGTCATTGCGGTTATGAATTTAAAGATTGATACAAATAAGCGTCAGGTTTATAGAAACGATGAACGA
ATTCGATTAACAGGTATGGAATTTAGTCTTTTAGAACTGTTGGTTAGTCGTTCAGGAGAACCTTTTAGTCGAGGTGAGAT
TCTTAAAGAAGTTTGGGGATATACACCTGAAAGACATGTTGATACGAGAGTAGTGGATGTTCATATTTCTAGACTTAGAT
CAAAACTTGAGGATGATCCTGCAAATCCAGAACTAATACTGACTGCAAGAGGAACAGGTTATCTTTTTCAAAGAATTGTT
GACTCTATGATTCCTGAAGGATCATAA

Protein sequence :
MTATSPSKETILVADDEASIRRILETRLSMIGYQVVTACDGNEALDLFRNCEPDLVVLDVMMPKLDGYGVCQELRKESDV
PIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCLLRRVEKEQIAGLPNSGVIAVMNLKIDTNKRQVYRNDER
IRLTGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPANPELILTARGTGYLFQRIV
DSMIPEGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NATL1_02061 YP_001014035.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-44 47
NATL1_02061 YP_001014035.1 two-component response regulator AE000516.2.gene3505. Protein 2e-40 47
NATL1_02061 YP_001014035.1 two-component response regulator HE999704.1.gene2815. Protein 6e-41 47
NATL1_02061 YP_001014035.1 two-component response regulator BAC0125 Protein 5e-38 46
NATL1_02061 YP_001014035.1 two-component response regulator NC_012469.1.7685629. Protein 7e-42 44
NATL1_02061 YP_001014035.1 two-component response regulator BAC0083 Protein 3e-34 43
NATL1_02061 YP_001014035.1 two-component response regulator BAC0638 Protein 2e-27 43
NATL1_02061 YP_001014035.1 two-component response regulator CP000034.1.gene3671. Protein 6e-38 43
NATL1_02061 YP_001014035.1 two-component response regulator HE999704.1.gene1528. Protein 2e-30 42
NATL1_02061 YP_001014035.1 two-component response regulator NC_012469.1.7686381. Protein 7e-38 42
NATL1_02061 YP_001014035.1 two-component response regulator BAC0197 Protein 6e-33 42
NATL1_02061 YP_001014035.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-34 41
NATL1_02061 YP_001014035.1 two-component response regulator BAC0308 Protein 6e-35 41
NATL1_02061 YP_001014035.1 two-component response regulator CP004022.1.gene3215. Protein 1e-32 41
NATL1_02061 YP_001014035.1 two-component response regulator CP001918.1.gene5135. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NATL1_02061 YP_001014035.1 two-component response regulator VFG1390 Protein 2e-38 45
NATL1_02061 YP_001014035.1 two-component response regulator VFG1389 Protein 3e-31 43
NATL1_02061 YP_001014035.1 two-component response regulator VFG0596 Protein 6e-33 42