Gene Information

Name : rpaB (P9303_26531)
Accession : YP_001018648.1
Strain : Prochlorococcus marinus MIT 9303
Genome accession: NC_008820
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : 3.1.1.61
Position : 2342841 - 2343587 bp
Length : 747 bp
Strand : +
Note : COG745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / transcription]

DNA sequence :
ATGACGGCCACCAGCCCATCTAAAGAGACGATCCTCGTGGTCGACGATGAGGCCAGCATTCGTCGGATCCTCGAAACCCG
CCTCTCGATGATCGGCTATCAAGTGGTCACCGCATGTGACGGCAACGAAGCTCTCGATCTCTTCCACAACTGTGAGCCTG
ATCTTGTTGTGCTCGACGTGATGATGCCAAAGCTTGATGGCTATGGCGTTTGTCAAGAGCTTCGCAAAGAATCGGATGTC
CCGATCGTGATGCTCACGGCCCTTGGAGATGTCGCTGACAGAATCACGGGGCTTGAGCTGGGTGCAGACGACTATGTCGT
CAAACCCTTCAGCCCCAAGGAACTTGAAGCGCGCATCCGCTGCGTGCTTCGGCGAGTCGAGAAAGAGCACGTTGCCGGCA
TCCCTAACTCAGGGGTGATTCAAGTGGCTGAACTAAGAGTCGACACCAACAAGAGACAGGTTTTCCGAGGAGATGAGCGG
ATTCGCCTTACCGGTATGGAATTCAGCCTGCTTGAGCTACTGGTCAGCCGCTCAGGGGAGCCTTTCAGCCGCGGCGAAAT
CCTCAAAGAGGTATGGGGTTATACACCTGAACGACATGTAGATACCAGGGTCGTGGATGTTCATATTTCACGTCTTCGCT
CCAAACTCGAAGACGATCCCGCCAATCCCGAGCTGATCCTCACCGCTCGAGGTACCGGCTACCTGTTCCAGCGCATCATC
GACTCCCTTGCCCCCGAAGGACTCTGA

Protein sequence :
MTATSPSKETILVVDDEASIRRILETRLSMIGYQVVTACDGNEALDLFHNCEPDLVVLDVMMPKLDGYGVCQELRKESDV
PIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRRVEKEHVAGIPNSGVIQVAELRVDTNKRQVFRGDER
IRLTGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPANPELILTARGTGYLFQRII
DSLAPEGL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rpaB YP_001018648.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-45 48
rpaB YP_001018648.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-45 48
rpaB YP_001018648.1 two-component response regulator BAC0125 Protein 2e-39 47
rpaB YP_001018648.1 two-component response regulator NC_002758.1121668.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator NC_009641.5332272.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator NC_013450.8614421.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator NC_007793.3914279.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-45 47
rpaB YP_001018648.1 two-component response regulator NC_002745.1124361.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator NC_009782.5559369.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator NC_002951.3237708.p0 Protein 4e-45 47
rpaB YP_001018648.1 two-component response regulator AE000516.2.gene3505. Protein 4e-40 46
rpaB YP_001018648.1 two-component response regulator NC_012469.1.7685629. Protein 1e-42 45
rpaB YP_001018648.1 two-component response regulator HE999704.1.gene2815. Protein 3e-41 45
rpaB YP_001018648.1 two-component response regulator BAC0083 Protein 3e-35 43
rpaB YP_001018648.1 two-component response regulator BAC0197 Protein 4e-34 43
rpaB YP_001018648.1 two-component response regulator BAC0638 Protein 6e-28 43
rpaB YP_001018648.1 two-component response regulator CP000034.1.gene3671. Protein 1e-38 43
rpaB YP_001018648.1 two-component response regulator BAC0308 Protein 2e-35 42
rpaB YP_001018648.1 two-component response regulator HE999704.1.gene1528. Protein 5e-31 42
rpaB YP_001018648.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-36 41
rpaB YP_001018648.1 two-component response regulator CP000675.2.gene1535. Protein 5e-35 41
rpaB YP_001018648.1 two-component response regulator CP001918.1.gene5135. Protein 7e-25 41
rpaB YP_001018648.1 two-component response regulator AE016830.1.gene1681. Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rpaB YP_001018648.1 two-component response regulator VFG1390 Protein 2e-39 45
rpaB YP_001018648.1 two-component response regulator VFG0596 Protein 8e-33 43
rpaB YP_001018648.1 two-component response regulator VFG1389 Protein 9e-31 43