Gene Information

Name : SSA_1565 (SSA_1565)
Accession : YP_001035505.1
Strain : Streptococcus sanguinis SK36
Genome accession: NC_009009
Putative virulence/resistance : Virulence
Product : two-component response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1568698 - 1569399 bp
Length : 702 bp
Strand : -
Note : GC: 45.58%; Codon Adaptation Index (CAI): 0.814. Curator(s): J. Alves

DNA sequence :
ATGAAGAAAATATTAGTTGTAGATGATGAGAAACCAATCTCAGATATTATTAAGTTTAATATGGCCAAAGAAGGCTATGA
GGTTTTGACTGCTTTTGATGGTAAGGAAGCCTTGGAAATGTTTGAAGCAGAACAGCCAGACATCTTGATTCTGGACTTGA
TGCTGCCGGAAGTGGACGGACTGGAAGTTGCTCGGACTATTCGCAAGACCAGCAATGTTCCGATTATTGTATTGTCTGCT
AAGGACAGTGAGTTTGACAAGGTTATCGGCCTTGAAATCGGTGCAGATGACTATGTGACCAAGCCTTTCTCAAATCGTGA
GCTGCAGGCGCGTGTCAAGGCACTTCTTCGTCGGGCAGACCTTGTTGTGGAAAACCAAGTAGAAGAAAGTGGCCCGAACG
AGTTGACCATTGGAGAACTGCAGATTTTGCCAGATGCTTTTGTTGCTAAGAAGCATGGCAAGGAGCTGGAGCTGACCCAC
CGTGAGTTTGAACTTCTTCACCATTTGGCGACACATATCGGACAAGTGATGACACGTGAGCACTTGCTGGAAACAGTATG
GGGCTATGACTATTTTGGTGATGTTCGTACAGTGGATGTCACAATCCGCCGCCTGCGTGAAAAGATTGAAGATACGCCAA
GCCGACCTGAGTATATCTTGACTCGCCGCGGAGTTGGCTACTATATGAGAAATAATGATTGA

Protein sequence :
MKKILVVDDEKPISDIIKFNMAKEGYEVLTAFDGKEALEMFEAEQPDILILDLMLPEVDGLEVARTIRKTSNVPIIVLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLRRADLVVENQVEESGPNELTIGELQILPDAFVAKKHGKELELTH
REFELLHHLATHIGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMRNND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-38 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_012469.1.7685629. Protein 9e-94 83
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_002952.2859905.p0 Protein 7e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_009641.5332272.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_013450.8614421.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_007793.3914279.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_007622.3794472.p0 Protein 6e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_002745.1124361.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_009782.5559369.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_002951.3237708.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_003923.1003749.p0 Protein 4e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_002758.1121668.p0 Protein 5e-57 56
SSA_1565 YP_001035505.1 two-component response transcriptional regulator HE999704.1.gene2815. Protein 3e-53 52
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AE016830.1.gene1681. Protein 8e-49 48
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_012469.1.7686381. Protein 2e-45 47
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AF155139.2.orf0.gene Protein 3e-41 46
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AM180355.1.gene1830. Protein 7e-39 45
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_014475.1.orf0.gen Protein 3e-39 44
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_005054.2598277.p0 Protein 3e-39 44
SSA_1565 YP_001035505.1 two-component response transcriptional regulator FJ349556.1.orf0.gene Protein 2e-40 44
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AE015929.1.gene1106. Protein 1e-34 42
SSA_1565 YP_001035505.1 two-component response transcriptional regulator CP001138.1.gene4273. Protein 1e-33 42
SSA_1565 YP_001035505.1 two-component response transcriptional regulator BAC0533 Protein 1e-33 42
SSA_1565 YP_001035505.1 two-component response transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-37 42
SSA_1565 YP_001035505.1 two-component response transcriptional regulator CP000647.1.gene4257. Protein 1e-33 42
SSA_1565 YP_001035505.1 two-component response transcriptional regulator HE999704.1.gene1528. Protein 8e-36 41
SSA_1565 YP_001035505.1 two-component response transcriptional regulator CP000034.1.gene3834. Protein 5e-33 41
SSA_1565 YP_001035505.1 two-component response transcriptional regulator NC_002695.1.915041.p Protein 5e-33 41
SSA_1565 YP_001035505.1 two-component response transcriptional regulator CP001918.1.gene5135. Protein 4e-28 41
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AF130997.1.orf0.gene Protein 9e-36 41
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AF162694.1.orf4.gene Protein 2e-34 41
SSA_1565 YP_001035505.1 two-component response transcriptional regulator AE000516.2.gene3505. Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSA_1565 YP_001035505.1 two-component response transcriptional regulator VFG1389 Protein 5e-34 45
SSA_1565 YP_001035505.1 two-component response transcriptional regulator VFG1563 Protein 9e-39 44
SSA_1565 YP_001035505.1 two-component response transcriptional regulator VFG1702 Protein 9e-39 43