Gene Information

Name : Cthe_3069 (Cthe_3069)
Accession : YP_001039458.1
Strain : Clostridium thermocellum ATCC 27405
Genome accession: NC_009012
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3610612 - 3611304 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulatory protein-like; KEGG: dsy:DSY1766 hypothetical protein

DNA sequence :
ATGAGAAAGATTCTTATTGTTGAAGATGATGAAAGCATAGGAGAGCTTTTGCGGGACTATCTTGAAATCAACGGCTTTTC
TGTGGACATATGCATGAATGGGACTGAAGGTTTAAAGCGTATCAGAGACGGGGAGTACGATCTTTTGATACTTGACATTA
TGCTGCCCGGTATGAATGGATATGAAATATTGAAAAAAATCCGGGATGAAAAAGATATTCCTGTGCTTATTGTGTCTGCA
AAGAAAGAAGAATTTGACAAAATTCACGGTTTGAAACTTGGAGCCGATGACTATATTACAAAACCTTTCAGTCCGGGGGA
GCTTGTGGCAAGGGTGAATGCTCACATAGCAAAATACGAGAGACTCAGAAACAAATATGGGAATAATAATGTAAATTCCA
TTACTATAAGAGGACTTGAAATTCAAAAGGATTCCAGAAGGGTTTTTGTGAACGGAAAAGAAGTAAATCTGGCACAAAAA
GAATTTGACGTTCTTTTGTTTTTGGCCCAGAATCCCAACAGAGTTTTTTCAAGGGAAGAGATTTTTGACAGAGTATGGGG
AATGGATGCTTTGGGAGATGCGGCAACAGTGACTGTTCATATTGGAAGAATAAGGGAGAAAATCGAGTCTGACCCTTCAA
ATCCCCAATATATTGAAACTGTCTGGGGAGCAGGGTATAGACTGAGAGCATAA

Protein sequence :
MRKILIVEDDESIGELLRDYLEINGFSVDICMNGTEGLKRIRDGEYDLLILDIMLPGMNGYEILKKIRDEKDIPVLIVSA
KKEEFDKIHGLKLGADDYITKPFSPGELVARVNAHIAKYERLRNKYGNNNVNSITIRGLEIQKDSRRVFVNGKEVNLAQK
EFDVLLFLAQNPNRVFSREEIFDRVWGMDALGDAATVTVHIGRIREKIESDPSNPQYIETVWGAGYRLRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_3069 YP_001039458.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-46 45
Cthe_3069 YP_001039458.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-46 43
Cthe_3069 YP_001039458.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-47 43
Cthe_3069 YP_001039458.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 4e-42 43
Cthe_3069 YP_001039458.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-42 43
Cthe_3069 YP_001039458.1 two component transcriptional regulator HE999704.1.gene2815. Protein 7e-42 43
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-40 42
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-40 42
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-40 42
Cthe_3069 YP_001039458.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-45 42
Cthe_3069 YP_001039458.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-45 42
Cthe_3069 YP_001039458.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-43 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator CP001581.1.gene280.p Protein 2e-40 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-43 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-42 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_3069 YP_001039458.1 two component transcriptional regulator VFG1563 Protein 2e-34 41
Cthe_3069 YP_001039458.1 two component transcriptional regulator VFG1702 Protein 1e-33 41