Gene Information

Name : Cthe_0799 (Cthe_0799)
Accession : YP_001037227.1
Strain : Clostridium thermocellum ATCC 27405
Genome accession: NC_009012
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 966229 - 966906 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulatory protein-like; KEGG: dsy:DSY3562 hypothetical protein

DNA sequence :
ATGAAAATACTGCTTGTCGAAGATGAAGTACGCCTTTCCGAAGCACTTGTACATACTTTAAAAAAGAACAATTACATAGT
TGACGTCGCTTTTGACGGGATAACAGGCCAGCAGATGGCTGAGACAAATATGTACAACGTCATTATCCTTGACAGAATGT
TGCCCAAAAAAGACGGGCTTGACGTTTTAAGAGATCTCAGAAAACAGGGTGTCACAACTCCTGTTCTGATTCTAACCGCC
AAAGATTCGGTAAAAAACAGAGTTGAAGGTCTTGACAGCGGCGCCGACGATTATCTGACAAAACCTTTTTCCAAAAGCGA
ATTACTTGCAAGAATACGAGCTTTGGGAAGAAGACAAAGCGAAATATTTGTAAATGAAGAAATAAATATAGGAAACATGA
GCTTTAACTGCATGAAGGGAGAAATAAAAGTAAACGGGCAAACCATAAAACTTACGTCAAAAGAATCGCAAATTTTGGAA
ATACTCATTAAAAACAAAAACATAGTGGTTTCAAAAGAGCAACTCCTTGAGAAAGTATGGGGCTTTCAAACAGATATTGA
GCTTAACAATATTGAAGTATATCTCTCATATCTTAGAAAAAAACTTTCAAAACTGGACTGCGGAATTGTGATTGAGACAA
TAAGAGCAAGGGGCTATTGCCTTAAGGAGGCACTGTAA

Protein sequence :
MKILLVEDEVRLSEALVHTLKKNNYIVDVAFDGITGQQMAETNMYNVIILDRMLPKKDGLDVLRDLRKQGVTTPVLILTA
KDSVKNRVEGLDSGADDYLTKPFSKSELLARIRALGRRQSEIFVNEEINIGNMSFNCMKGEIKVNGQTIKLTSKESQILE
ILIKNKNIVVSKEQLLEKVWGFQTDIELNNIEVYLSYLRKKLSKLDCGIVIETIRARGYCLKEAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-29 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 44
Cthe_0799 YP_001037227.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-27 42
Cthe_0799 YP_001037227.1 two component transcriptional regulator BAC0083 Protein 1e-30 42
Cthe_0799 YP_001037227.1 two component transcriptional regulator BAC0347 Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_0799 YP_001037227.1 two component transcriptional regulator VFG0596 Protein 2e-29 42
Cthe_0799 YP_001037227.1 two component transcriptional regulator VFG1390 Protein 6e-34 41