Gene Information

Name : Sbal_0459 (Sbal_0459)
Accession : YP_001048859.1
Strain : Shewanella baltica OS155
Genome accession: NC_009052
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 524284 - 524595 bp
Length : 312 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: sfr:Sfri_4014 transposase IS3/IS911 family protein

DNA sequence :
ATGAGATCGACAACCAGAAAAACATTTAGTGCTGAATTCAAACTTGAAGCAGCCCAATTAGTCCTTGATAAAAACCATAG
CATCATCGAAGCTGCAAAGGCGATGAACGTAGGTAAATCCACTATGGATAAATGGGTGAGACAGTTAAAACTAGAACGCC
AGGGTGGCATACCAAAAGCATCTCCGATTACCCCTGAACAAATTGAAATCCGTGAGCTGAAGAAGCAAATAGCTCGTCTT
GAGGAGCACAATCTTATCCTAAAAAAGGCTACCGCTCTCTTGATGTCAGACTCGATGAACAATTTACGCTAA

Protein sequence :
MRSTTRKTFSAEFKLEAAQLVLDKNHSIIEAAKAMNVGKSTMDKWVRQLKLERQGGIPKASPITPEQIEIRELKKQIARL
EEHNLILKKATALLMSDSMNNLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 82
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-32 82
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 82
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-32 82
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 82
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 82
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 82
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-32 82
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-26 67
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-26 67
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-25 66
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-21 64
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-26 62
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-23 62
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-26 62
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-26 62
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-26 62
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 9e-27 62
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-26 62
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-20 55
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-16 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 46
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-15 45
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 3e-11 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal_0459 YP_001048859.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-32 82
Sbal_0459 YP_001048859.1 transposase IS3/IS911 family protein VFG1485 Protein 2e-26 67
Sbal_0459 YP_001048859.1 transposase IS3/IS911 family protein VFG1553 Protein 1e-23 62
Sbal_0459 YP_001048859.1 transposase IS3/IS911 family protein VFG0784 Protein 2e-26 62
Sbal_0459 YP_001048859.1 transposase IS3/IS911 family protein VFG1566 Protein 1e-12 46
Sbal_0459 YP_001048859.1 transposase IS3/IS911 family protein VFG1521 Protein 1e-11 44