Gene Information

Name : Mjls_4629 (Mjls_4629)
Accession : YP_001072885.1
Strain : Mycobacterium sp. JLS
Genome accession: NC_009077
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 4863765 - 4864127 bp
Length : 363 bp
Strand : +
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: mmc:Mmcs_4250 arsenate reductase

DNA sequence :
GTGGCATCGACTGACGGGCGGCCCGCCGCCGTGATCTACCACAACCCGAAGTGCTCGACGTCGCGTAAGACCCTGGATCT
GTTGCGCGAGAACGGTATCGAGCCCGACGTGGTGCAGTACCTCAAGACACCGCCGTCACGCGCCGAACTCGCCGCGATGA
TCGAGGCCGCCGGGATCGACGTGCGCACCGCGGTCCGCAAACGCGAAGCGCTGTACAACGAACTGAATCTGGCCGACGCG
ACCGACGACGAGTTGCTCGACGCGCTCGCCGAGCACCCGATCCTCATCGAGCGGCCGTTCGTGGTGACCGACAAGGGCAC
CCGGCTGGCCCGGCCGATCGACGCGGTGCGCGAGATCCTGTGA

Protein sequence :
MASTDGRPAAVIYHNPKCSTSRKTLDLLRENGIEPDVVQYLKTPPSRAELAAMIEAAGIDVRTAVRKREALYNELNLADA
TDDELLDALAEHPILIERPFVVTDKGTRLARPIDAVREIL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 1e-21 53
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 1e-21 51
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 2e-21 51
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 2e-18 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mjls_4629 YP_001072885.1 arsenate reductase BAC0583 Protein 2e-19 54
Mjls_4629 YP_001072885.1 arsenate reductase BAC0584 Protein 2e-19 52
Mjls_4629 YP_001072885.1 arsenate reductase BAC0582 Protein 5e-19 51
Mjls_4629 YP_001072885.1 arsenate reductase BAC0585 Protein 2e-18 49