Gene Information

Name : Mjls_4830 (Mjls_4830)
Accession : YP_001073086.1
Strain : Mycobacterium sp. JLS
Genome accession: NC_009077
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5080155 - 5080856 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_4448 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACAGTGGTGTGGGATCGCCCCGGGTACTGGTCGTCGACGACGACCCCGACGTGCTGGCGTCTCTGGAGCGCGGGTT
GCGGCTGTCCGGGTTCGACGTGTCCACCGCGGTGGACGGCGCCGAGGCGCTGCGCAGCGCCACCGAGACGCGCCCCGATG
CGATCGTCCTCGACATCAACATGCCGGTGCTCGACGGCGTCAGCGTGGTCACGGCGTTGCGCGCGATGGACAACGACGTG
CCGGTCTGCGTGCTGAGCGCGCGCAGCAGTGTCGACGACCGGGTGGCCGGTCTGGAGGCGGGCGCCGACGACTACCTCGT
CAAACCCTTCGTGCTGGCCGAGCTCGTGGCCCGGGTCAAGGCACTGTTGCGTCGGCGCGGTTCGTCGGCGACCTTCTCGT
CGGAGACCATCCAGGTCGGCCCGCTCGAGGTCGACATCCCCGGCCGGCGGGCCCGTGTCAACGGCGCCGACGTCGACCTG
ACCAAACGTGAATTCGACCTGCTGGCGGTGCTGGCCGAGCACAAGACCGCGGTGCTCTCCCGCGCCCAGTTGCTCGAACT
GGTCTGGGGTTACGACTTCGCCGCCGACACCAACGTCGTCGACGTGTTCATCGGATACCTGCGCCGCAAGCTCGAGGCGG
GCGGCGCGCCCCGCCTGCTGCACACCGTGCGCGGTGTGGGATTCGTCCTCCGGACCCAATAG

Protein sequence :
MDSGVGSPRVLVVDDDPDVLASLERGLRLSGFDVSTAVDGAEALRSATETRPDAIVLDINMPVLDGVSVVTALRAMDNDV
PVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSSATFSSETIQVGPLEVDIPGRRARVNGADVDL
TKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRTQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mjls_4830 YP_001073086.1 two component transcriptional regulator BAC0083 Protein 4e-32 46
Mjls_4830 YP_001073086.1 two component transcriptional regulator BAC0125 Protein 1e-30 45
Mjls_4830 YP_001073086.1 two component transcriptional regulator BAC0197 Protein 3e-25 44
Mjls_4830 YP_001073086.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-29 44
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-31 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-28 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator BAC0638 Protein 3e-24 42
Mjls_4830 YP_001073086.1 two component transcriptional regulator BAC0308 Protein 2e-27 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator BAC0111 Protein 4e-27 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-28 41
Mjls_4830 YP_001073086.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mjls_4830 YP_001073086.1 two component transcriptional regulator VFG1389 Protein 9e-84 95
Mjls_4830 YP_001073086.1 two component transcriptional regulator VFG1390 Protein 1e-41 50
Mjls_4830 YP_001073086.1 two component transcriptional regulator VFG1386 Protein 5e-36 45
Mjls_4830 YP_001073086.1 two component transcriptional regulator VFG0596 Protein 5e-26 42