Gene Information

Name : terD (CD630_16350)
Accession : YP_001088136.1
Strain : Clostridium difficile 630
Genome accession: NC_009089
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1895036 - 1895614 bp
Length : 579 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 7765497, 10203839, 19368559; Product type f : factor

DNA sequence :
ATGGCTATAGTATTAAAAAAAGGACAAAAAATCGATTTAACTAAGGGAAATCCAGGTCTTAAAAATATAAAACTTGGACT
AGGATGGGATACAAATTCATTTGATAGTGGCTATGATTATGATTTAGATGTAAGTGTTTTCATGGTTGGAGAATCTCAAA
GAGTTGAAAAAGATGAAGATTTTATATTCTACAATAACTTAAAACATCCATCTGGAGCAGTTGAACACTTAGGTGATAAT
AGAACTGGTGAAGGTGATGGAGATGATGAGGAAATATTAGTGAATTTAGAGACAATGCCAAAGCATATACAAAAGATAGC
TGTAACAGTTACAATATATGAGGCTGCTGAAAGAAGACAAAATTTTGGACAAGTAAGTAACTCATATATAAGAGTATTAA
ATTCTGAAAATGATGAAGAAATATTAAGATATGACTTAGGTGAAGAATTTAGTATAGAAACTGCAATTACAGTATGTGAG
ATATATAAGTATAATGGAGAATGGAAGTTTAGTGCAGTTGGAGCAGGATTTGAAGGTGGCTTAGAGGCACTTTGTAGAAA
CTATGGCTTAAATGTTTAA

Protein sequence :
MAIVLKKGQKIDLTKGNPGLKNIKLGLGWDTNSFDSGYDYDLDVSVFMVGESQRVEKDEDFIFYNNLKHPSGAVEHLGDN
RTGEGDGDDEEILVNLETMPKHIQKIAVTVTIYEAAERRQNFGQVSNSYIRVLNSENDEEILRYDLGEEFSIETAITVCE
IYKYNGEWKFSAVGAGFEGGLEALCRNYGLNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-49 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-44 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-44 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-44 53
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-48 52
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-48 52
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-48 51
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-45 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_001088136.1 Tellurium resistance protein BAC0390 Protein 1e-45 52
terD YP_001088136.1 Tellurium resistance protein BAC0389 Protein 3e-48 52