Gene Information

Name : CD630_33600 (CD630_33600)
Accession : YP_001089877.1
Strain : Clostridium difficile 630
Genome accession: NC_009089
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3924171 - 3924884 bp
Length : 714 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 18689481, 18790863; Product type r : regulator

DNA sequence :
ATGGATACATGTTTTAATAAAAAAATATTACTTGTTGATGATGAAAAGGATATAGTAGATTTAATTGAAGAAGTACTCAT
AAATGATGGTTTTAAAAACATTATTAAAGCTTATAATGGTCTAGATGCTATTTCGCTCTGTAAGATAGCATGTCCAGATG
TTGTCATTCTTGATATAATGTTACCAGATATAGAGGGTATAGAAGTGTGTAAAAAAATTCGAGAGTTTTCATACTGTTCT
ATTCTTTTTTTATCATCAAAAAATGATGATATTGACAAAATACTAGGTCTTAGTAGTGGGGGAGATGACTATATAACAAA
GCCATTCAGTCCAAGAGAAATTGCTTTTCGAGTTAAAGCGCAATTACGTAGACAACAGTATCAAAGCATTGTACCATCAG
ATAGTGAAGTTATTAAAATAGGAGATATTACTATTGATATAGAAGGAAACCGTGTATATAAAGATATAAATGAGATTGAG
TTAACTGGAAGGGAGTATCATCTTTTAAGCTACATGGCTCAAAATGTAAATAAAATTATAGGAAAAGAAAGACTCTATGA
ACAAGTATGGGGAGTATATAGTAGTATTTGTGACAATACAATTATGGTGCATATACGACATATAAGAGAAAAAATTGAAG
ATAACCCCTCAAATCCTAAAATACTTATAACAGTTAAAGGACTAGGATATAAACTTGTGAATAGAATCGATTAG

Protein sequence :
MDTCFNKKILLVDDEKDIVDLIEEVLINDGFKNIIKAYNGLDAISLCKIACPDVVILDIMLPDIEGIEVCKKIREFSYCS
ILFLSSKNDDIDKILGLSSGGDDYITKPFSPREIAFRVKAQLRRQQYQSIVPSDSEVIKIGDITIDIEGNRVYKDINEIE
LTGREYHLLSYMAQNVNKIIGKERLYEQVWGVYSSICDNTIMVHIRHIREKIEDNPSNPKILITVKGLGYKLVNRID

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 3e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CD630_33600 YP_001089877.1 two-component response regulator AF130997.1.orf0.gene Protein 3e-34 44
CD630_33600 YP_001089877.1 two-component response regulator DQ212986.1.gene4.p01 Protein 2e-37 44
CD630_33600 YP_001089877.1 two-component response regulator AM180355.1.gene1830. Protein 6e-38 44
CD630_33600 YP_001089877.1 two-component response regulator NC_012469.1.7685629. Protein 2e-39 44
CD630_33600 YP_001089877.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-43 44
CD630_33600 YP_001089877.1 two-component response regulator NC_014475.1.orf0.gen Protein 4e-38 41
CD630_33600 YP_001089877.1 two-component response regulator NC_005054.2598277.p0 Protein 4e-38 41