Gene Information

Name : CD630_03700 (CD630_03700)
Accession : YP_001086837.1
Strain : Clostridium difficile 630
Genome accession: NC_009089
Putative virulence/resistance : Virulence
Product : HTH-type transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG1476
EC number : -
Position : 440311 - 440511 bp
Length : 201 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 12568329, 12568327, 17650959, 11157942,11073898, 8863741,11839496, 11292341; Product type r : regulator

DNA sequence :
ATGATTAAGAACAGAATTAAAGAATTTAGGGCAAGATATGATATGAAACAAGACGACTTAGCGAAAGCAGTCGGTGTTCG
ACGAGAAACGATTGGTAATCTTGAAAAAGGACGATACAATCCCTCTCTTGTATTAGCTTGGAATATTGCAAAAACATTTC
ATGTAACGATTGAAGAAGTTTTTACAGTAATAGACGATTGA

Protein sequence :
MIKNRIKEFRARYDMKQDDLAKAVGVRRETIGNLEKGRYNPSLVLAWNIAKTFHVTIEEVFTVIDD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH2314 YP_254229.1 hypothetical protein Not tested ¥ðSh1 Protein 5e-10 41
ef0042 AAM75247.1 EF0042 Virulence Not named Protein 1e-05 41
EF0524 NP_814301.1 Cro/CI family transcriptional regulator Not tested Not named Protein 2e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CD630_03700 YP_001086837.1 HTH-type transcriptional regulator VFG2168 Protein 6e-06 41
CD630_03700 YP_001086837.1 HTH-type transcriptional regulator VFG2175 Protein 6e-06 41