
|
Name : ureA (P9301_08911) Accession : YP_001091115.1 Strain : Prochlorococcus marinus MIT 9301 Genome accession: NC_009091 Putative virulence/resistance : Virulence Product : urease subunit gamma Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0831 EC number : 3.5.1.5 Position : 766238 - 766540 bp Length : 303 bp Strand : + Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter DNA sequence : ATGCATCTTTCACCTCAAGAAAAGGATAAATTATTGATTTTTTCTGCTGCACTCTTAGCTGAAAGAAGGCTTAGTCGAGG TCTTAAGCTTAATTATCCTGAAACAGTTGCTTTTTTGAGTTTTCAAGTTCTTGAAGGAGCACGAGATGGAAAAAGTGTAA GTCAATTAATGTCAGAGGGAACTACCTGGCTTTCAAAATCACAAGTTATGGAGGGCATTCCTGAAATGGTCGATGAAGTC CAAATAGAAGCAGTTTTCCCTGATGGGACAAAGTTAGTTACTATCCACAATCCAATTAACTAG Protein sequence : MHLSPQEKDKLLIFSAALLAERRLSRGLKLNYPETVAFLSFQVLEGARDGKSVSQLMSEGTTWLSKSQVMEGIPEMVDEV QIEAVFPDGTKLVTIHNPIN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 5e-26 | 71 |
| ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 5e-26 | 71 |
| ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 6e-29 | 64 |
| ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 6e-29 | 64 |
| ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 6e-29 | 64 |
| ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 6e-29 | 64 |